KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_01965Help
Entry
CLIBASIA_01965    CDS       T00948                                 

Gene name
folD
Definition
(GenBank) methylenetetrahydrofolate dehydrogenase/cyclohydrolase protein
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00670  One carbon pool by folate
las01100  Metabolic pathways
las01120  Microbial metabolism in diverse environments
las01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CLIBASIA_01965 (folD)
Enzymes [BR:las01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     CLIBASIA_01965 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     CLIBASIA_01965 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH
Motif
Other DBs
NCBI-ProteinID: ACT56979
UniProt: C6XF27
Position
769318..770238
Genome map
AA seq 306 aa AA seqDB search
MGSLIDGKVVASVLTDKIAESVAFLKKETGVQVGLAVVLVGNDPASCSYVSAKTRMAKHC
GFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEKDVD
GLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQL
LLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIKTGSLVIDVGINRINSP
QLGKTVLVGDVADECKSVVGAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSPKFDAQS
IAKKTI
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgggttctttgatagatggaaaagttgtagcttctgtacttactgataaaattgctgaa
tctgttgcgtttttgaaaaaggaaacaggtgttcaggtcggtcttgcagttgtgttagta
ggaaacgatcctgctagctgttcttatgtatcagctaaaacacggatggctaaacattgt
ggttttcattcagttcagtataattttcctgtagatatctctcagattgatttggaaaat
gctgtattatcactcaacaaagatgattcgatacatggcatattagtgcaactaccactt
ccttctacggtatctgagcagtcgattatccaatctattgttccggaaaaagatgtagat
ggtcttcatgtggttaatgcaggcaaagtgatgatcggtgattttacgacaggtcttgtc
ccttgtactccagcaggagcaatattattaattgagcaatttaaaggatgtgatctatcg
ggtcaacatgctgtggtcatagggcgatctaatctttttggtaagccgatggggcaatta
ttgctttctagaaatgcaacagttactatggcacattccaagactaaaaatttgccggaa
atctgtagaaccgctgatatccttgttgttgccgttggtagacctcgtatggtgcaagtc
gattggattaaaacaggatctttggttatagatgtaggtattaatagaatcaattctcct
caactaggaaaaactgtattggtaggagacgttgcagatgaatgtaaatctgttgtagga
gcgattacccctgttccaggaggagtcggtccaatgacgatagcaatgcttatggcgaat
acagtcattgcagcgtaccgctctttggggatgaaatcaccaaaatttgatgcacaatca
atagcaaaaaaaactatataa

DBGET integrated database retrieval system