KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02020Help
Entry
CLIBASIA_02020    CDS       T00948                                 

Definition
(GenBank) DNA-methyltransferase MKpn2kI
  KO
K00558  DNA (cytosine-5)-methyltransferase 1 [EC:2.1.1.37]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00270  Cysteine and methionine metabolism
las01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CLIBASIA_02020
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:las03032]
    CLIBASIA_02020
   03036 Chromosome and associated proteins [BR:las03036]
    CLIBASIA_02020
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:las02048]
    CLIBASIA_02020
Enzymes [BR:las01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     CLIBASIA_02020
DNA replication proteins [BR:las03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   DNA methylation enzymes
    CLIBASIA_02020
Chromosome and associated proteins [BR:las03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    CLIBASIA_02020
Prokaryotic defense system [BR:las02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    CLIBASIA_02020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_methylase
Motif
Other DBs
NCBI-ProteinID: ACT56990
UniProt: C6XF38
Position
complement(762494..762799)
Genome map
AA seq 101 aa AA seqDB search
MKACDFGVPQRRERLYIIDFLNPSVEFKFPTPLGIKPRLGDILEEHIDDKSTISNKLWEG
HQKRKENNKIAGKGFGYGLFFENSATTNTLSARYYKDGSEI
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcttgtgatttcggagtaccgcaaagacgagaacgattatatattatagacttc
cttaacccgtccgtagaatttaaatttcccactcctctaggaataaaaccgagattggga
gatattctagaagaacatatagatgataaatctacgattagcaataaactgtgggaaggg
catcaaaagagaaaagaaaataataaaattgctggaaaaggttttggctacggtctgttt
tttgaaaattccgcaaccacaaacacgctttctgcccgttattacaaagatggaagtgaa
atttaa

DBGET integrated database retrieval system