KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02070Help
Entry
CLIBASIA_02070    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flg_hook
Motif
Other DBs
NCBI-ProteinID: ACT57000
UniProt: C6XF48
Position
754108..755301
Genome map
AA seq 397 aa AA seqDB search
MKEVNNISYKGLLEANQYSLGHNDDRLNSIQEEKRNNSTKTINKNPNKQDFDVQNKSLFE
IFLTTIPDADNHIHEDEERLIDNDLIYNSYKGAMYPSASQYFTVRDLSASEKDFPSIESF
ASKSPQDIEDISGFLSPDFSILLKNKTDRDYSDGLCTITDVFSQLKSDSGSFSNYLRHRK
EMFSEDVPLNPVDFLLEKQLDTASLGEEICNLKGFSVPSRYQSSDSLDALMSTESVLNQK
SFMRVTMIPESVHYTDTGSIKALTIQMKPNSPDNIVATLCLSGEKLSVKLRVESDFLYKK
IQSGRQNILDALNFSGYTMDRFDVEFVRKDSLDLLKDSMNYCAQQQGFTHSNEFEKKKLY
FPERERTEKKFFWGEKRSGLIYNKGEIIGIYSNYIYV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagtcaacaatatctcctataaaggtcttcttgaggctaatcaatattcttta
ggtcataacgatgatcggttaaattctattcaagaagaaaagcggaataattctactaaa
actataaataaaaatcctaataaacaagattttgatgttcaaaataaatctttatttgaa
atttttttaactacaattcccgacgcagataaccatattcatgaggatgaagaaaggttg
attgataatgatttgatatataattcttacaaaggagctatgtatcctagtgcatcacaa
tatttcactgtacgggatctttctgctagtgagaaggattttccttctatcgaatctttt
gcttcaaagagcccccaagatattgaggatatttcaggatttttatcccctgacttttct
attcttttaaagaacaaaacagatagagactattctgatgggttatgtaccataacagat
gtattttcccaattgaaatcagattctggttcatttagtaattatctgaggcatagaaaa
gaaatgttttcagaggatgttcccttgaatccggttgattttttgttagaaaagcaattg
gatacagcatcattaggtgaagaaatatgcaatttaaaaggtttttctgtcccgagtaga
taccagtctagtgatagtcttgatgctttgatgtctacagagagtgtgctcaatcaaaaa
tcttttatgcgtgttaccatgattccagaatctgtacattacacagatacaggttctatt
aaggctttaacaatacagatgaaacctaatagtcctgataacattgttgctacgctgtgt
ttgtccggagaaaaattatctgtcaagctacgagtagaatcggattttctttataagaaa
attcaaagtggacgccaaaatattttagatgcattgaatttttcaggatatacaatggat
cgttttgacgtggagtttgtgcggaaagactccttagatcttttaaaggattcaatgaat
tattgcgcacaacagcaaggttttacgcactcaaacgagtttgaaaagaaaaaattgtat
tttcctgaaagagagcgcacggagaaaaaatttttttggggagagaagaggagtggtctt
atttataataagggcgaaattataggaatatattctaattatatctatgtataa

DBGET integrated database retrieval system