KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02225Help
Entry
CLIBASIA_02225    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
  KO
K09798  uncharacterized protein
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    CLIBASIA_02225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_2 DUF2913
Motif
Other DBs
NCBI-ProteinID: ACT57031
UniProt: C6XF79
Position
722593..723783
Genome map
AA seq 396 aa AA seqDB search
MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY
SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT
RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGL
GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD
SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF
DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA
FDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgagtatcgatttaaaccatcctttaaggaaaaagacgcctaagagaaaatctttttat
tcacagattatttctcgattaggtctttttttgttgttctgtacttttattgtcgggctt
tcgatttacattttaatttcacatgcttttgtcggaacgatatcagagatgattccgtac
tctgttattagagaaattgctcctattccattgacgattcctcttaatattgaggataaa
caatctcctagtaagagagataataataccgtttgtaatcaacttaagaatgattcatcc
caacatgatggtcaaattcagaatgatatttctggtaagacagtcgtcaataaaccgaca
agatcgacgtccatagattccttgccaacgatagaggaaagattgattctaggactatct
aaaaaagagttattggcaaaaaataaggtaggacgggaagataccgaagttcctgctatg
gataagaatttttgttccaatgctagtggtgcgcgtatagctattgttgtttctggtttg
ggtataagtcagaccggaacacaacgtgctattaatttattgcctgcaaacatcacactt
gcttttgcttctaatggcaatagtttagataggtggatgaaagaagcaaagaaaaagggg
caagaggctattttacagattcctatgcaggcttttgatgaatcgtataatgaagatgat
tcttatactttaaaagtaacacaaacagttcagcagttacttaatcgattacgctattct
ttgcgacgtggtacaggatatttcggtgttatgaattatcgtggagccatgttattgtcc
aataaggaatctgcggaagttatctttaaagaatttgctaagcgtggattattgtttttt
gatgatggtagttcaccacgtaatcttactagagtattagctccaaaattgaatcttcct
tatatggtagctgatttgtatttagatgatcaggtagaccgggataagatcagagagaaa
ttaaagggattagaagagattgctcgcactacgggacaagctattggtgttgcagttgct
tttgatgagagtatcgaagtgatttcacaatggttgcaacaggaacatgtacgcgatgta
tcagttgttcctttatcgtgtttagctaaattatcgtccccttcttcataa

DBGET integrated database retrieval system