KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02235Help
Entry
CLIBASIA_02235    CDS       T00948                                 

Gene name
thiP
Definition
(GenBank) thiamine transporter membrane protein
  KO
K02063  thiamine transport system permease protein
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:las00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CLIBASIA_02235 (thiP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:las02000]
    CLIBASIA_02235 (thiP)
Transporters [BR:las02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Thiamine transporter
    CLIBASIA_02235 (thiP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACT57033
UniProt: C6XF81
Position
719549..721156
Genome map
AA seq 535 aa AA seqDB search
MAKCCQPSIRNALWPGVIISCFLNFIFFLVVYSLWRHMPLISWREFMEDSYLWHVIGFTF
WQALLSTLLSVIPSIFLAKSLFRRHFPGRILFLRLHTMIFVLPVFVVIMGVFTVYGRTGW
IAQLCQWLGIVYQFNLYGIKGILLVHVFFNMPLAIRMLLQALDSISIEQRQLALQLGMNP
WYFFRFVEWPYLRRQILPTSSLIFMLCFASFATVLTLGGGPASTTIELAIYQSLSYDFDL
NKAAFLSLVQIFCCLSLVLFNQKFNVSFSSGYSSRFLWKNEDDSRWSRWWDFFLISCAIW
FFILPLLAIIIEGMNAKLLLRLLQQSGLWSSFFNSIYIAINAGVLCMIFTIMLLWTKREL
RLRRLKFFNHIFELSELLILAVPSIVLAVGFFLLLKNTVNLTSSSYSLIIVTNALMAVPY
AVKILENPMYDLAERYNALCISLQIKGINRLYLIEFKALKRLMAQTFSFSCLLSIGDFGI
IALFGNDNFCTLPCYLYQQLGSYRQSDAVVTALLLLSLCLGLFSLLEYLSGKEYD
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatgctgtcagccgtctataagaaacgctttgtggcctggtgtaattatttct
tgttttttaaactttattttttttcttgttgtttattctttatggcgacatatgcctcta
ataagttggcgagaatttatggaggatagttatttatggcatgtcattggttttacattt
tggcaggcattactttctactttattatctgttattccttcaatttttttagcaaaatct
ctttttcggcggcattttccagggcgtatattatttttgcgactacatactatgattttc
gtattgcctgtatttgtagtgattatgggtgtattcactgtatatggacggacgggatgg
attgctcaattgtgtcaatggttgggtattgtctatcaatttaatctttacggaatcaaa
ggtattttgttagtacatgtgttttttaatatgccgctagctattcgtatgttgttacaa
gcgttggatagcatttctatcgaacaacgtcaacttgcgctacaattaggcatgaatcca
tggtatttttttcgttttgttgaatggccttatttaagaaggcaaattttaccaacatcc
tctttgattttcatgttatgctttgccagttttgcgacagtgcttactcttggaggaggg
ccagcttcaactactattgaattagcgatctatcagtcattaagttatgattttgatctc
aataaagcagcctttctttccttggttcaaattttttgctgtttaagtttggtattattc
aatcaaaaatttaatgtttctttttcttcaggatatagttcacgattcttgtggaagaat
gaagatgatagtcgatggagcaggtggtgggatttttttcttatcagttgtgcaatatgg
tttttcattcttcctttgttggccattatcattgaaggcatgaatgcaaagttgttattg
cggctattacaacaatctggattatggagttcatttttcaattctatttatattgctata
aatgctggtgtattgtgtatgatctttactatcatgttgctctggactaagagagaattg
cgtctgcgtcgtctaaaattttttaatcacatttttgaattgagtgaattattaatttta
gctgttccgagcattgtattagcagtaggattctttttgttactcaagaatactgttaat
ttaacctcttcttcctatagtttaataatagtgaccaacgctttaatggctgttccttat
gcagttaaaatattagaaaatccgatgtatgatttagcagagcgatataatgcattatgt
atttcattacaaatcaaagggataaatcgactataccttattgaatttaaggctttgaag
cgtttgatggcacaaactttttctttttcttgtttactttcgataggagattttggcatt
attgcgctttttggcaatgataatttttgtactttaccgtgctacctctatcaacaactg
ggttcttaccgtcaaagtgatgctgtagttacagcgctgttattactatcactttgtttg
ggactattcagtttattagaatatttgtcaggaaaagagtatgattaa

DBGET integrated database retrieval system