KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02270Help
Entry
CLIBASIA_02270    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA ABC_tran RsgA_GTPase IstB_IS21 AAA_16 AAA_33 DNA_pol3_delta AAA_29 Gtr1_RagA Roc NACHT Sigma54_activat AAA_5 AAA_22
Motif
Other DBs
NCBI-ProteinID: ACT57040
UniProt: C6XF87
Position
714486..715226
Genome map
AA seq 246 aa AA seqDB search
MNLMKEDYSFFVPDKQKNDQPKNKEEQLFFSFPRCLGISRDDLLVHSAIEQAVRLIDSWP
SWPSRVVILVGPSGSGKSCLANIWSDKSRSTRFSNIAKSLDSILIDTRKPVLLEDIDLLD
FNDTQLFHIINSIHQYDSSLLMTARTFPVSWGVCLPDLCSRLKAATVVKISLPDDDFLEK
VIVKMFADRQIFIDKKLAAYIVQRMERSLVFAEKLVDKMDNLALSRGMGITRSLAAEVLK
ETQQCD
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttatgaaggaggattatagtttctttgttcctgataagcaaaaaaatgaccag
ccaaagaacaaggaagaacagctttttttctcttttcctaggtgtcttggaatcagtcga
gacgatcttttggtacatagtgctattgagcaggctgtacgtcttatagattcttggcca
tcttggccatcacgtgtcgtgattctcgttggtccaagtggttctggaaaatcttgtttg
gctaatatatggtccgataagagtagatctacaaggtttagtaatattgccaaaagcttg
gattctattttgatagatacgcgaaaaccagtattactagaggatattgatctcttagat
tttaatgatacccaactatttcatattattaatagtattcatcaatatgattcgagcttg
ttgatgacggcgcgtactttccccgtttcttggggagtgtgtttaccggatttatgttct
cgtttgaaggcggcaacagtagtcaagatcagtttgccagatgacgattttttagaaaaa
gtaatagttaaaatgtttgctgatcggcagatttttattgataaaaaacttgctgcttac
attgtgcaacgtatggaaagatctttagtttttgcagaaaaactagttgataaaatggat
aacttagccttatctcggggcatggggatcacgcgttcccttgctgctgaagtactaaag
gaaacacaacagtgcgattaa

DBGET integrated database retrieval system