KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02285Help
Entry
CLIBASIA_02285    CDS       T00948                                 

Gene name
purN
Definition
(GenBank) phosphoribosylglycinamide formyltransferase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00230  Purine metabolism
las00670  One carbon pool by folate
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
las01130  Biosynthesis of antibiotics
Module
las_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLIBASIA_02285 (purN)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CLIBASIA_02285 (purN)
Enzymes [BR:las01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     CLIBASIA_02285 (purN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N
Motif
Other DBs
NCBI-ProteinID: ACT57043
UniProt: C6XF90
Position
complement(712566..713183)
Genome map
AA seq 205 aa AA seqDB search
MIRKNIVIFISGEGTNMLSLIQATKKNDYPAEIVGVFSDNSNAQGLVKARKEKVPTFPIP
YKDYISRREHEKAILMQLSSIQPDLICLAGYMRLLSRDFVESYKNKILNIHPSLLPLFPG
LHTHRRVLQSGIKITGCTVHMVTANMDEGPIIAQAAVPVSSQDTESSLSQKVLSAEHLLY
PLALKYTILGKTSNSNDHHHLIGIG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtaaaaacattgtgatatttatatccggagaaggcacaaatatgctctctctt
attcaagctactaagaaaaatgattatcctgctgaaatcgtaggggttttttcagataat
tctaatgcacaaggacttgtcaaagcacgaaaagaaaaagtacctacttttcccattccg
tataaagattatatttctcggcgagagcatgaaaaagcaattctcatgcaactctcttct
atacagccagatctaatatgccttgcgggatatatgcgtcttctgagcagagatttcgtg
gaatcctataagaataaaattcttaatatccacccgtccctactccccctcttcccaggg
cttcatacgcaccgtcgcgtcttacaatccggcattaaaatcaccggatgtacggtacac
atggttactgcaaatatggacgaaggcccaattattgctcaggcagctgtacctgtatcc
tcacaggatacggaatcaagcctttctcaaaaagttctatccgccgaacacttactatat
cctttagcgcttaaatatacgattctggggaaaacgtctaactccaacgaccatcatcac
ctcatcggaataggataa

DBGET integrated database retrieval system