KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02290Help
Entry
CLIBASIA_02290    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TadE Tad TadF
Motif
Other DBs
NCBI-ProteinID: ACT57044
UniProt: C6XF91
Position
711849..712397
Genome map
AA seq 182 aa AA seqDB search
MKCIKNYILRFLSRENGVVAVEMAIILPILLLIYMAVYEITMLYTLSKRLTRFASHMGDM
VAQETSINKQYLQGFENFLRATMYPYRTPNHSIIVTGYWLDNKQIVRKMWNWSSSNVKVE
REDIPASIKDASTFIVRAEVSINYRTLVFSKILPDSLKGDIVLRKVYYYRQRLGDQIVCR
DC
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtattaaaaattatatcttacgatttttatctcgggaaaatggtgtggttgca
gtagaaatggcaattattctacctattttgttgctaatttacatggcagtatatgagata
accatgctctatactttgtctaaacgtttaacgcgtttcgcaagtcacatgggagacatg
gttgcacaagaaacttcaatcaataaacaatatttacaaggttttgagaattttttacgt
gccactatgtatccttatagaactccaaatcattctattattgtgactggttattggctc
gataataagcaaatagttaggaaaatgtggaattggtcttccagcaatgtgaaggttgaa
agagaggatattcctgcttccatcaaggatgcttctacgtttattgtacgtgctgaagtt
tctattaattaccgtacgcttgttttttcaaaaatattaccagattctctgaaaggggat
attgttctaaggaaagtttactactatcgtcaacgtttaggtgatcagatagtttgtaga
gattgttaa

DBGET integrated database retrieval system