KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02330Help
Entry
CLIBASIA_02330    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF218
Motif
Other DBs
NCBI-ProteinID: ACT57052
UniProt: C6XF99
Position
complement(702176..702799)
Genome map
AA seq 207 aa AA seqDB search
MRYFWYGLFVCLIFFIMGFISFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQ
IGEKIFISGVHHSVSKDILLQKIPIRQDLAECCIDIGYKALNTEGNAQEASAWAEKNNFH
HVLIVTHDYHMPRTFLELQRINSTVQFIPYPIISHDLEENSSIFKIKILRVLLIEYLKIL
LLSIQLSLSTQTASQFFITLIEEITVK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
ttgcgctatttttggtatggccttttcgtatgtttaattttttttatcatggggttcatc
tcatttatacgatatgttaaacaaatgcacatacctgatcatccttctgtcagcgctatc
gttgtgctaacaggagaaccgattcggatagaaagggcatttgaattgcttgaaaatcaa
ataggagaaaaaatttttatatcaggagtccaccattctgttagcaaagacattctactt
caaaaaatccctatacgacaagatttagcggaatgttgcatcgacataggatataaagct
cttaatacagaaggtaatgctcaagaggcatccgcttgggctgaaaaaaataattttcat
catgttctcattgttactcatgactatcacatgcccagaacattccttgaattacaaaga
ataaatagcaccgtacagtttatcccgtatcctataatcagtcatgatttggaagagaat
agttcaatcttcaagataaaaatattaagggtattgcttatcgaatatctaaagatactg
ctattatccatacaattatccctatccacacaaactgcatcacaattttttataacatta
attgaagaaataactgtaaaatag

DBGET integrated database retrieval system