KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02470Help
Entry
CLIBASIA_02470    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LprI Exonuc_V_gamma
Motif
Other DBs
NCBI-ProteinID: ACT57080
UniProt: C6XFC7
Position
complement(669428..669823)
Genome map
AA seq 131 aa AA seqDB search
MCRKIIFALTIIAIAFQSMALNCNETLMQADMNQCTGNSFALVKEKLEATYKKVLEKVEK
HQRELFEKSQMAWEIYRGSECAFAASGAEEGTAQSMIYANCLQGHAIERNEKLESYLTCP
EGDLLCPFINN
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagaaaaattatctttgcacttactattattgccatagcatttcaatcaatggct
cttaattgcaacgaaactttaatgcaagccgatatgaatcaatgcacaggaaattctttt
gcactagtaaaagagaaactagaagcaacatataaaaaagtcttagaaaaagttgaaaag
catcaaagagaattatttgaaaaatcacaaatggcatgggaaatataccgaggttctgaa
tgcgcctttgctgcttctggagcagaagaaggaactgcacaatcaatgatttatgcgaat
tgtctacaaggacatgccatcgaacgaaatgagaaactagaatcctaccttacatgtcca
gaaggcgatctgctctgcccatttataaataattga

DBGET integrated database retrieval system