KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02490Help
Entry
CLIBASIA_02490    CDS       T00948                                 

Gene name
rpoH
Definition
(GenBank) RNA polymerase factor sigma-32
  KO
K03089  RNA polymerase sigma-32 factor
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:las03021]
    CLIBASIA_02490 (rpoH)
Transcription machinery [BR:las03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     CLIBASIA_02490 (rpoH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4 Sigma70_r1_2 HTH_11 Sigma70_r4_2
Motif
Other DBs
NCBI-ProteinID: ACT57084
UniProt: C6XFD1
Position
complement(664409..665317)
Genome map
AA seq 302 aa AA seqDB search
MNRKNMSIIVNGEIGLSRYIHEIRKIPMLEKQEEYVLAKRYREHGDLSAAHRLVTSHLRL
VVKIAMGYRGYGLPISEVVSEGNIGLMQAVKKFDPERGFRLATYSMWWIKAAMQEYILRS
WSLVKIGTTANQKRLFFNLRRLKGHLQAITDNNLKPEQVVAIAKKLNVSESEVISMNCRL
AGDESLNALINSSDKNSSQWQDWLVYDHDGQEQVLIEKEERKNRRNMLTRSMSVLNPRER
RIFEARRLQENPVTLENLSSEFEVSRERVRQIEARAFKKVQESIQKQVELSSSPPLLQKP
RY
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtaaaaacatgtctataatagtaaatggcgaaattggactcagtcgttatatt
cacgagatacgaaaaattcctatgttggaaaaacaagaagaatatgtgcttgctaaaaga
tatcgtgagcatggtgatttaagcgctgcacacagattagtgacaagccatctcaggctt
gtcgtcaaaattgcgatgggttatcgcggttatggcttgcctatcagcgaagtcgtatcc
gaaggcaatatagggctgatgcaggcagttaaaaaatttgatccagaacgtggttttcgt
cttgctacatacagcatgtggtggattaaagccgcaatgcaagaatatattttgcgttca
tggtcactagtgaaaataggaaccacagctaatcaaaaacgtcttttcttcaatttacga
cgtctaaaaggacatctacaagctataactgataacaatttaaaaccggaacaagtcgtt
gccatcgctaaaaaacttaatgtttcggaatcagaagtaatttcgatgaattgtcgccta
gctggagacgagtctctcaatgctctcatcaattcttcagacaaaaattctagccaatgg
caagattggttagtatatgatcacgatggccaagaacaagtacttattgaaaaagaagaa
cgaaaaaatcgtcgtaacatgcttacccgttctatgtctgtattaaatccccgagaaaga
aggatttttgaagcacgacgtctgcaagaaaatcctgtaacacttgagaatttatcatct
gagtttgaagtaagtcgcgaacgcgtacgacaaatagaagcacgtgcttttaagaaagta
caagaatcaatacaaaagcaggtagagctatcgtcttctccccccctactacaaaaaccg
agatattga

DBGET integrated database retrieval system