KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02545Help
Entry
CLIBASIA_02545    CDS       T00948                                 

Gene name
dfp
Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00770  Pantothenate and CoA biosynthesis
las01100  Metabolic pathways
Module
las_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CLIBASIA_02545 (dfp)
Enzymes [BR:las01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     CLIBASIA_02545 (dfp)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     CLIBASIA_02545 (dfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ACT57095
UniProt: C6XFE2
Position
649367..650584
Genome map
AA seq 405 aa AA seqDB search
MDLSGKKIALIMCGSVAVYKSLDLIRRLRERGAVVIPVMTKSAQKFITPLIVGAISNRRV
YTHLLSYKEGYESNHIQLANECDLLVVAPASANFIAHVAHGMVYDLASAILLAKGDQPVL
IAPAMNFMMWAKPATQRNVEILQKDGCYFIGPESGAMAESNGYGVGRMSEPCDIIRQITW
LLYKSKELLLKGKRALVTSGPTYEPLDPMRYIANRSSGQQGHAIAKSLAYFGAEVILISG
PVSIADPPNVMTIHVERAEDMLQEVLKALPVDIAVMVSAVSDWRFPKIAGTKIKRKDIGD
TMRIDLMENPDILKIIGHHQCRPSIVVGFAAETQCIEQNAREKLLNKGADFIVSNCILPD
TGFVGKEWNKVSIVFPDKIEEYPELPKAEVADRLCHLIVEHLGMK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggatctttcgggaaaaaagattgctctgatcatgtgtgggagtgttgctgtctataaa
agtttagatcttattcgtcgactgcgagaaaggggtgcagtggttatccctgttatgact
aagtcagcgcaaaagtttataactccattgatagtaggggctatatctaatcgtcgtgtg
tatacgcatttattgtcttataaagaagggtatgagagtaatcatattcaattagcaaat
gaatgtgatctattggtagtagcgcctgcatctgctaattttattgctcatgtagcgcac
gggatggtatatgatttagcgtctgctattttattagcaaaaggagatcaacctgttctt
atagcgccggcgatgaattttatgatgtgggctaagccggctacacaacgtaatgtcgag
attttacaaaaggatggatgttattttataggccctgaaagtggagcaatggctgagagt
aatggttacggagtaggaaggatgtctgagccatgtgatattataaggcaaataacatgg
ttgttatataaaagcaaagaactgcttttaaaagggaaacgtgctttagtaacttcaggg
ccgacatacgagccgctagatcccatgcgctatattgcaaatcgttcttcaggacaacaa
gggcatgcaattgccaaatctctcgcgtatttcggagcagaggtgatattgatatcaggg
cctgtttcaattgctgatccgccaaatgttatgactattcatgttgagcgggcggaggat
atgttgcaagaagttttgaaagcattgccggtagatatagcagtgatggtatctgcagta
tcagattggagattccctaagattgcggggacaaaaataaaacggaaagacataggtgat
actatgagaatagatcttatggagaatcctgatatactcaaaattataggacatcatcaa
tgccgcccgtctattgttgtaggatttgcggctgagacacagtgtattgagcagaatgct
cgggaaaaattattaaacaaaggagcggattttattgtatcaaattgtattttgccagac
actggattcgtggggaaagagtggaataaggtaagtattgtctttccagataaaatagag
gaatatcctgaattacctaaagcggaagtggcagataggttgtgtcacttgattgtagaa
catcttggtatgaagtga

DBGET integrated database retrieval system