KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02575Help
Entry
CLIBASIA_02575    CDS       T00948                                 

Definition
(GenBank) coproporphyrinogen III oxidase
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C Radical_SAM_C
Motif
Other DBs
NCBI-ProteinID: ACT57101
UniProt: C6XFE8
Position
641905..643092
Genome map
AA seq 395 aa AA seqDB search
MKYLSAYENNMTGQGSNSLGVYVHWPFCVKKCPYCDFNSHVRRYKVGQENFIQSFLTEMQ
WMRQLTGPRSISSIFFGGGTPSLIEPQNIALILDGIAKNWTVSSNVEITIEANPSSVEVN
NFQGYRKAGVNRISLGVQSLEEQSLRFLGRNHNASEAIAAIHLARNIFPRMSFDLIYALP
KQTMTQWEMELQRALSYAVDHLSLYQLTIEKGTLFYKMHKDGDLVLPSENVAVDLYNLTQ
SITSAHGLHAYEISNHSFLGAESLHNLNYWRYGDYIGIGPGAHSRVKVGSHRVAISIEKH
PESWLKMVRKNGHAVVEKEFLSSEQQADEFLMMGLRLREGISVKDWEMLAGRNLDIECER
NLQRQGFIERVQFSRLRCTQRGMTMLDSVIANLAV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatctcagtgcatacgaaaataatatgacaggtcagggatccaattctctagga
gtttatgtccattggcctttctgtgttaaaaaatgtccctactgtgattttaacagtcat
gttcgacgttataaagtgggtcaagaaaatttcattcaatcttttcttacagaaatgcag
tggatgagacaattgactggacctcgatcaatttccagtattttctttggtggagggacg
ccttctctgatagagccgcagaacattgcgcttattcttgatggtatagcaaagaattgg
actgtatcgtcaaatgttgaaattaccattgaggctaatccttctagtgtagaagtgaat
aattttcaaggatatagaaaagcgggtgtgaatcgcatttctctaggtgtgcaatcttta
gaggagcaatccttaaggtttttaggtcgcaatcataatgcttccgaggctattgcagcc
atacatttagcgcgcaatatttttccacgcatgtcttttgatttaatatatgccctacca
aaacaaactatgacacaatgggaaatggaattgcaaagagctctttcttatgcggtagat
catctttcgctttatcagcttacaatagaaaaaggaacattgttttacaagatgcataaa
gatggagatctcgttcttcctagcgaaaatgttgccgtggatctttataatttgactcaa
agcattactagtgcacatgggttacatgcatatgaaatatctaatcattcttttctaggt
gccgaaagtttacataatctgaattattggagatacggtgattatattggaattggtcca
ggggcacatagtcgtgttaaggttggttctcaccgagtggcaatatcgatagaaaaacat
cctgagagttggttaaaaatggtgagaaaaaatggacatgctgttgttgaaaaagaattt
ctaagctctgaacagcaggctgatgaatttttaatgatgggtttgagattaagagaagga
ataagtgtcaaggattgggaaatgttagcagggcgtaatttggatattgaatgtgaaaga
aatcttcaaagacaaggctttattgagcgcgttcaattttcaagattacgatgcactcag
cggggaatgacgatgttggactcggtaatagcaaatcttgctgtatag

DBGET integrated database retrieval system