KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02595Help
Entry
CLIBASIA_02595    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT57105
UniProt: C6XFF2
Position
complement(638344..638559)
Genome map
AA seq 71 aa AA seqDB search
MINGPETLESLMVSFRVDMSPAVQLQCGLGSSIVAVKPVVPYITDVARGQINVRLGDNYG
VLHSVDLVTMT
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatggaccggagacgcttgaatcattgatggtatcatttcgcgtggatatgtca
ccagcggttcaattgcaatgtggtcttggttctagtattgttgctgttaaacctgttgtg
ccgtacatcactgatgttgctcgtggtcaaatcaacgtgcgtctgggtgataattatggt
gttcttcattctgtcgatttagtgactatgacgtag

DBGET integrated database retrieval system