KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02600Help
Entry
CLIBASIA_02600    CDS       T00948                                 

Definition
(GenBank) creatinine amidohydrolase
  KO
K01470  creatinine amidohydrolase [EC:3.5.2.10]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00330  Arginine and proline metabolism
las01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    CLIBASIA_02600
Enzymes [BR:las01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.10  creatininase
     CLIBASIA_02600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Creatininase
Motif
Other DBs
NCBI-ProteinID: ACT57106
UniProt: C6XFF3
Position
637325..638128
Genome map
AA seq 267 aa AA seqDB search
MNPLIIFTDNSLPLCADARKDWIVVLPLGAYEQHGPHLPMNTDTIIAAGLAERIKSILPP
RLPVTCMPVEPIGYSIEHMYVDGTKTLTYAEAIEHWLAIIDAIRKMGIRKIVILNAHGGN
SPLVSIVSTEARMRFSMLVVSTSWSRFTIPQGIISFPETEIGIHGGEIETSMMLALAPHL
VKMDLAENFSSRQSEFLRNFKYLRAHGSHSFGWSMKDLNPKGVVGNAMDATVKKGEGLLS
YFANCFIQLLNDINSFDVSIFDKDVQK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaacccattgatcatatttacagataattctctacctttatgcgctgatgcacgcaaa
gattggatagtggtactaccgttaggagcatatgaacaacatggtccacatttaccgatg
aatactgatactattattgcagcaggattagcagagcgtatcaaaagtattcttccccct
agacttcctgttacctgtatgccagtagaacccattggttattcaattgaacacatgtat
gttgatgggacaaagactctcacttacgctgaagctatagaacattggttagctataata
gatgcaatacgaaaaatgggaatacgtaagattgtcattttgaatgcgcatggtggtaat
tcacctttggtatctatcgtctctacagaagcgcgaatgcgtttttcaatgttagtagta
tctactagttggtcgagatttactattcctcagggtattatttcgtttccagaaaccgaa
attgggatacatggaggggaaatagaaacgagtatgatgttggcgcttgcccctcattta
gtaaaaatggatttagcggaaaatttttcctcgcgacaatcggaattcttgcgtaatttt
aaatatctacgcgcgcatgggtcacatagttttggatggagcatgaaggatttaaatcct
aaaggagttgtgggcaatgccatggatgctactgttaaaaaaggagagggtttgctctca
tattttgcgaattgtttcattcagcttctcaatgatatcaattcttttgatgtaagcata
tttgataaagatgttcaaaaataa

DBGET integrated database retrieval system