KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02655Help
Entry
CLIBASIA_02655    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fib_alpha
Motif
Other DBs
NCBI-ProteinID: ACT57117
UniProt: C6XFG4
Position
complement(626580..627449)
Genome map
AA seq 289 aa AA seqDB search
MIRKNEKLKEACDVATDSIRSFFMQAKPYILPALSKEEQKSLKYFFLPENTLCQKFFNAF
DRHATAGIEIKKTMNATLQFLQKVPTADPQAVEYEKPYSTVIANLTDSHQKYATNIATYM
PIGEEFAHSLSARIASSENAQVIEALYDIVKNRNDIMLLTKYGESLQILRRLTQETEKHI
NNLQDKILQDRAKEIKHWYDTLIPHPDDSSPNSGVSFDIMEPGHEKTNIYALSYGEQMSA
PANLSECQLNCLGLAVWGSCAPLLNNHHLALSFSIIQFNRWMITTLKVL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgatacgaaagaacgagaaacttaaagaggcttgcgatgttgccactgattcaatccgg
tcttttttcatgcaagcaaaaccatatatcttacctgcactctccaaagaagaacaaaaa
tcgctcaaatattttttcctgcccgagaacacgttatgccagaaattctttaatgctttt
gatcggcacgctactgcaggcatagaaatcaaaaaaactatgaatgctactttgcaattt
ttgcagaaggtaccgacggcagatcctcaagcggtagaatacgagaaaccatactccacg
gttattgccaatctgactgattcccatcaaaagtacgcaacaaacatcgctacctatatg
cctattggggaagagtttgcacacagcctttctgcgcgcattgcctcttctgaaaacgcg
caagttattgaagccctgtacgatattgttaaaaaccgtaatgatatcatgttgctaaca
aagtatggagaatcactgcaaatcctacggcgcctaacgcaggaaaccgaaaaacatatc
aataacttacaggataagattctacaagatcgcgcaaaggaaataaaacattggtatgat
accctcatccctcatcctgatgattcaagccctaattcaggagtaagttttgacattatg
gaacctggacatgagaaaacaaatatatatgccttgagctacggtgagcagatgtcagca
ccggcaaacctcagtgagtgtcagcttaattgcttgggcttagcggtatggggctcatgt
gcgccacttctcaacaatcaccatttggctttatcgttttcgataatccaattcaatcga
tggatgataaccacactgaaagttttatag

DBGET integrated database retrieval system