KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02675Help
Entry
CLIBASIA_02675    CDS       T00948                                 

Gene name
obgE
Definition
(GenBank) GTPase ObgE
  KO
K03979  GTPase [EC:3.6.5.-]
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:las03009]
    CLIBASIA_02675 (obgE)
Enzymes [BR:las01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     CLIBASIA_02675 (obgE)
Ribosome biogenesis [BR:las03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   CLIBASIA_02675 (obgE)
 Prokaryotic type
  GTPases
   CLIBASIA_02675 (obgE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP1_OBG MMR_HSR1 FeoB_N AAA_33
Motif
Other DBs
NCBI-ProteinID: ACT57121
UniProt: C6XFG8
Position
complement(623661..624668)
Genome map
AA seq 335 aa AA seqDB search
MKFLDEAKVYIRSGDGGAGGISFRREKFIEFGGPDGGSGGRGGDVWIQATSNLNTLIDFR
YQQHFKAQHGEKGMKRNRSGAKGEDVVLTVPVGTQVFEEDGISLICDLDQEGQRIILAPG
GNGGFGNAHFKSSTNQAPYYANPGILGQEKIIWLKLKLIADIGIIGLPNAGKSTFLASVT
RAKPKIADYPFTTLYPNLGIVKEGYKEFILADIPGIIKNAHQGAGIGDRFLKHTERTHVL
LHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQIDTVDSDTLARKKNELATQC
GQVPFEFSSITGHGIPQILECLHDKIFSIRGENEF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttctagatgaagcaaaagtttatattagatcaggagatggaggtgctgggggc
atttcttttcgacgtgaaaaatttattgagtttggcggaccagatggtggatcaggtgga
cgtggtggagacgtatggattcaagccactagcaatctcaatactttgatagattttcgc
tatcaacagcattttaaagcacaacatggcgaaaaaggcatgaaacgaaaccgtagcggt
gcaaaaggcgaagatgtcgtacttactgttcctgtcggaacacaggtattcgaggaagat
ggaattagccttatttgtgatctcgatcaagaagggcaacgtattatattagcacctggt
ggtaatggcggttttggcaacgctcacttcaaatcatctactaatcaggcaccttattat
gccaatcctggcatccttggacaagaaaaaattatttggcttaaattgaaactaattgct
gatattggaattattggtctccctaacgcagggaaatcgacttttttagcctcggtaaca
agagcaaagcctaaaattgctgattatccgtttactaccttgtatcctaacttaggaatc
gtaaaagaaggatataaagaatttatattggcagatatccctggaatcattaaaaatgcc
catcaaggtgcaggcattggagatcgatttctaaagcataccgaacgcacgcatgtctta
ttgcatatcgtttctgctcttgaagagaatgtccaagcggcgtatcaatgtatcctagat
gaattatccgcttataatagcgagttgcgcaaaaaaatagaaatagtgggcctttcccaa
atagatacagtggatagtgatacccttgctaggaaaaaaaacgaacttgccactcaatgc
ggacaggtaccatttgaattttcatctattacaggacatgggataccacaaatattggaa
tgtcttcatgataaaattttttctatccgaggagaaaatgaattctaa

DBGET integrated database retrieval system