KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02750Help
Entry
CLIBASIA_02750    CDS       T00948                                 

Definition
(GenBank) carbonate dehydratase
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00910  Nitrogen metabolism
las01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CLIBASIA_02750
Enzymes [BR:las01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     CLIBASIA_02750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_CA
Motif
Other DBs
NCBI-ProteinID: ACT57136
UniProt: C6XFI3
Position
complement(604985..605608)
Genome map
AA seq 207 aa AA seqDB search
MTSFPNTLLERHREFIQDQYDKKLFQELANQQKPKIMIISCCDSRVAPETIFNAKPGELF
VVRNVANIVPPYEPDGQHHATSAAIEFAVQGLNVEHIVVMGHGRCGGIQAVLDSNNSSTS
PGDFIGKWMDIVRPIAQKIVANNPTEKQTILEQLSIRNSLKNIRNFPFVNKLEKEHMLQI
HGAWFDISSGKLWILDPTSNEFTCDTR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgactagctttcctaacaccttacttgaacgtcatcgcgagttcattcaagatcagtat
gataaaaagttatttcaagaactcgcaaatcaacagaagcctaagataatgattatctct
tgttgtgattcacgtgtcgcacccgagacaatattcaatgctaaaccaggagagctcttt
gtagtacgcaacgtcgcaaatattgtgccaccctatgagccagatggacaacatcacgca
acttctgctgcaattgaatttgcagtacaagggcttaatgttgaacatatagtggttatg
ggtcatggacgttgcggaggaatacaagctgttttagactcgaataattcttctacctct
cctggagattttatcggaaaatggatggacatcgtacgtcctattgctcaaaaaatagtt
gcaaacaatcctaccgaaaaacaaactattctagaacaactctcaattcgcaattcctta
aagaatatacgcaatttcccttttgttaacaaattggaaaaagaacatatgctacaaatc
cacggcgcttggtttgatattagctctggcaaactatggatcttggatcctacaagcaat
gaattcacctgtgataccagatga

DBGET integrated database retrieval system