KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02770Help
Entry
CLIBASIA_02770    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT57140
UniProt: C6XFI7
Position
600729..600860
Genome map
AA seq 43 aa AA seqDB search
MMKGLLHADDIEFRFTAVQRLVFAFYPSAVVWEFGRILTATCQ
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaggacttcttcacgctgacgatatcgaatttaggttcaccgccgttcagaga
ctggttttcgctttttatccttctgcagtagtatgggagtttggaaggatattgacagcg
acgtgtcaataa

DBGET integrated database retrieval system