KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02785Help
Entry
CLIBASIA_02785    CDS       T00948                                 

Gene name
eno
Definition
(GenBank) phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00010  Glycolysis / Gluconeogenesis
las00680  Methane metabolism
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
las01120  Microbial metabolism in diverse environments
las01130  Biosynthesis of antibiotics
las01200  Carbon metabolism
las01230  Biosynthesis of amino acids
las03018  RNA degradation
Module
las_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLIBASIA_02785 (eno)
  09102 Energy metabolism
   00680 Methane metabolism
    CLIBASIA_02785 (eno)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CLIBASIA_02785 (eno)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:las03019]
    CLIBASIA_02785 (eno)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:las04147]
    CLIBASIA_02785 (eno)
Enzymes [BR:las01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     CLIBASIA_02785 (eno)
Messenger RNA biogenesis [BR:las03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CLIBASIA_02785 (eno)
Exosome [BR:las04147]
 Exosomal proteins
  Proteins found in most exosomes
   CLIBASIA_02785 (eno)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Motif
Other DBs
NCBI-ProteinID: ACT57143
UniProt: C6XFJ0
Position
complement(597494..598768)
Genome map
AA seq 424 aa AA seqDB search
MFINDIIAREVIDSRGSPTIEVDVCLEDGSTGRAMVPSGASTGIHEAFELRDQEKRYFGK
GVLKAIAFVNDEIRTALLGCDARDQLLIDKIMIDLDGTPNKSRLGANAILGVSLAVSKAA
AQTSNLPLYKYLGGCSAHILPVPLMNILNGGIHADNALDFQEFMIMPVGAENIREAIRMG
AEVFHTLKKELKSKGYSTNVGDEGGFSPNLKTADSALDLIANSIEKAGYNAGKDLLIALD
CAASAFFKKEKYILKGENLELQPNEMASYLANLVDQYPIYSIEDGMSEDDWHGWKILTNK
IGSNCQLVGDDLFVTNPERLHKGINEEVANAILIKPNQIGSVSETLNTIEKAQMAGYPSI
ISHRSGETEDHTIADLAVATNCGQIKTGSLARSDRIAKYNQLIRIEESLGKQAKFAGRSI
LIHQ
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgttcattaacgatattatcgcccgcgaagttattgatagccgaggaagccccactatt
gaagtagatgtttgtctggaagatggaagtacaggtcgtgctatggttccttctggagca
tctactggaattcacgaagcttttgaattacgcgatcaagaaaaacgttactttgggaaa
ggggttctaaaagctattgccttcgttaacgacgaaattcggacagcgttgctgggatgt
gatgcaagagaccaacttctcatcgataaaataatgattgatcttgacggcacgcctaat
aaatctcgtcttggtgccaacgctattctcggcgtatctcttgctgtatcaaaagccgca
gcacaaacttccaatcttcctttatacaaatatttagggggatgtagcgcccatattctt
cctgtccccttgatgaatattttgaatggcggcatccatgccgataatgctcttgacttt
caagaatttatgataatgcccgtgggcgcagaaaatataagagaagctattcgcatggga
gcggaagtatttcataccttaaaaaaagaactgaaatcaaaaggatacagcactaacgtc
ggagatgaaggagggttttctcccaatcttaaaacagccgattctgcgcttgatttaatt
gccaactctatagaaaaagcaggatataacgcaggaaaagatttgcttattgctcttgat
tgcgctgctagcgcattttttaaaaaggaaaaatacattttaaaaggtgaaaatctagaa
ctgcaaccaaatgagatggcatcttaccttgccaatcttgttgaccagtatcccatctac
tccatagaagatggaatgtccgaagatgactggcatggatggaaaattctaactaataaa
ataggatcaaactgtcagttagtaggagatgatttatttgtcaccaatcctgaacgtttg
cataaagggataaacgaagaagtcgcaaacgcgatactcatcaaacctaaccaaataggt
tctgtttctgaaacgctcaacaccatagaaaaagcgcagatggcaggatatccaagcatt
atctctcatcgttcgggagaaacagaagaccacacaatagcagatttagcagtcgcgact
aattgcggacaaatcaaaacaggatctctagcgcgatcggatagaatcgcaaaatacaac
caattaatccgaattgaagaaagccttgggaaacaagctaagtttgcaggacgatccata
cttattcaccaataa

DBGET integrated database retrieval system