KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02860Help
Entry
CLIBASIA_02860    CDS       T00948                                 

Gene name
flgF
Definition
(GenBank) flagellar basal body rod protein FlgF
  KO
K02391  flagellar basal-body rod protein FlgF
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:las00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    CLIBASIA_02860 (flgF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:las02035]
    CLIBASIA_02860 (flgF)
Bacterial motility proteins [BR:las02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    CLIBASIA_02860 (flgF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flg_bbr_C Flg_bb_rod
Motif
Other DBs
NCBI-ProteinID: ACT57158
UniProt: C6XFK5
Position
582061..582792
Genome map
AA seq 243 aa AA seqDB search
MQTSFNIGLAAQLALEQRLSTVADNMSNTDTVGFRTIKVKFSEVVGAIKNDIDQKISFVA
SGKEYLSKEVGSFISTGTELDFALEGDAWFALESPRGIILTRDGRFKVTDDGSLVSASGK
YPVLDMASVPIQIPQKDEIFNVGEKGEISQKGKVIATMGLYSVDMSQGFVRRENSGISPN
IPPTPLEDLSGVTVKRGFLEDSNANSMYEMGQMIHLTQKFNSITTLIDENEKSMLEAIRN
IAS
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcagacatcttttaacattggtcttgctgcacaacttgctttggaacagagactttct
actgtagcagataatatgtctaataccgatactgtgggttttcgtacgattaaagttaaa
ttttctgaagttgtaggtgccatcaaaaatgatattgatcaaaaaatatcttttgttgca
tctggaaaggaatatctttcaaaagaagttggatcctttataagtacgggaacggaatta
gattttgctctagaaggagatgcttggtttgcattggaaagtcctagaggaattattttg
actcgggatggtcgttttaaggttacagacgatggatcattggtatcggcaagtgggaaa
tatcccgttcttgatatggcaagtgtaccaattcagatacctcaaaaggatgaaatattt
aacgtgggagaaaaaggagaaatatctcaaaaaggtaaagtgatcgcgaccatggggctc
tattctgtagatatgtcgcaaggttttgttcggcgcgagaatagcgggatatcgcctaat
attcctcctacacctcttgaggatctttctggagtaacggttaaacgaggttttttagaa
gattctaacgctaattctatgtatgagatgggtcagatgattcatttaacacaaaaattc
aattctattactacgttaattgacgagaatgaaaaatccatgttggaggcgataagaaat
atcgcatcgtaa

DBGET integrated database retrieval system