KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02900Help
Entry
CLIBASIA_02900    CDS       T00948                                 

Definition
(GenBank) transcriptional regulator protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerE Sigma70_r4_2 Sigma70_r4 HTH_23 HTH_24 HTH_40 HTH_10 Terminase_5 HTH_29 Raf1_HTH HTH_11 HTH_17 RepB Sigma70_ECF
Motif
Other DBs
NCBI-ProteinID: ACT57166
UniProt: C6XFL3
Position
575763..576470
Genome map
AA seq 235 aa AA seqDB search
MSENTLTGKKSSSLQELSPRLHLIQNRIKARNFALYTINSALDFPRRQQLICELHNYDLD
SGDIPNILIETYGDDFLFHFNSGLLPIIWQSIQEETVIESSGQLSVRLEGGLLPFAGIAF
PVRLGFHKNGYVIFTSEFLMLANEVIIEAHGACYQVITDFLELFKKRSSAARNLTERETS
CLQLAGDGYTSEEIAEKLGLSVHTVNAYLGSATVKLDAVNRIQAIAKAIRFGYIC
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgaaaatacgctcacggggaaaaaatcatctagtcttcaagaactctctccaagg
ctacatttaatacaaaatagaataaaagcaagaaattttgctttgtatacaattaatagt
gcgctggattttccaaggcgtcagcaattgatttgcgaattgcataattatgatttggat
agtggtgatattcccaatattttaatcgagacatatggggatgatttcttatttcacttt
aattcaggacttttaccaataatatggcagagtatacaagaagaaactgtgattgaatcg
tcaggacaattatccgttagattagagggaggattattgccatttgccggcattgccttt
cctgtccgtcttggtttccataagaatggatatgtgatttttacttcagaatttctgatg
cttgctaacgaagttattattgaagcgcatggagcttgttatcaagtaatcacggatttt
ttggaactctttaaaaaacgttcttccgctgctagaaatctgacagaacgagaaacttca
tgtctacagttggcaggagatggttatactagtgaagagattgccgaaaaattaggctta
tcagtacatacggtcaatgcataccttggatcagcaacagtcaagttagacgccgtcaat
cgcattcaagcaattgccaaagcaattcgttttggatacatttgctga

DBGET integrated database retrieval system