KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_02985Help
Entry
CLIBASIA_02985    CDS       T00948                                 

Gene name
dapF
Definition
(GenBank) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00300  Lysine biosynthesis
las01100  Metabolic pathways
las01110  Biosynthesis of secondary metabolites
las01120  Microbial metabolism in diverse environments
las01130  Biosynthesis of antibiotics
las01230  Biosynthesis of amino acids
Module
las_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    CLIBASIA_02985 (dapF)
Enzymes [BR:las01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     CLIBASIA_02985 (dapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase
Motif
Other DBs
NCBI-ProteinID: ACT57183
UniProt: C6XFN0
Position
555450..556340
Genome map
AA seq 296 aa AA seqDB search
MQSSMVDFAKMEGIGNKILVIDMRGCHDNITSDAINALSTDDNTHFDQIMLIHDFQDASV
DAFIRIINCDGSEVQSCGNGMRCVVRFLTSRMKRKSFTFETIRGILVAKENRDGSISVDM
GEPILDWKLIPLARSFDKMDRDRFHIGPVNHLFLRNPFVVSMGNPHAIFFVEDDLYHYDL
ASFGNLLAKHPMFSEGVNLSIARVTSLESLDLRTWERGVGLTAACGSAACASVVASGCLH
KTNRAVSVKMLGGGLLIEWHDNNHVFMTGEAKKEWEGKLDIKTGKWIKKNEDDEAY
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcatctatggtagattttgcaaaaatggaagggatagggaataaaattcttgtc
attgatatgcggggttgtcacgataatataacctcagacgcaattaatgctctatccacg
gacgataatacccattttgatcaaattatgttaattcatgattttcaagatgcatctgtc
gatgcctttattcgtattataaactgtgatggatccgaagtgcagtcttgtgggaatggg
atgcgttgtgttgtgcgatttcttacgtctaggatgaagagaaagtctttcacttttgaa
accatacgaggaattttagtggctaaagaaaatagggatggatcgatctctgttgatatg
ggtgagccgattttggattggaagctcattcctctggcacgatcatttgataagatggat
agggatcgatttcatataggtccagttaatcacttgtttttgcggaatccgtttgtggtt
tctatggggaatccacatgcaattttttttgtagaagatgacttatatcattatgacctt
gctagttttggaaatcttttagcaaagcatcctatgttttcggaaggtgttaatctttct
atagcacgggttacttctttagaatctcttgatttacgcacttgggagcgtggcgtaggt
ttaactgctgcctgtggatcagctgcttgtgcttctgttgttgcgtctggatgtttgcac
aagacaaatcgtgcggtatcagttaagatgttgggaggagggcttttgattgagtggcat
gataataaccatgtttttatgactggagaggcgaaaaaagaatgggaggggaaactggat
attaaaacggggaaatggataaagaaaaatgaggatgatgaggcatattaa

DBGET integrated database retrieval system