KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_03120Help
Entry
CLIBASIA_03120    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT57210
UniProt: C6XFQ7
Position
complement(532696..532878)
Genome map
AA seq 60 aa AA seqDB search
MARTQIALALSFFMITHSYYAFSQDEIKKNNPTLEKKPIVLMKHEIQEKKTLAAFTSFAS
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcactcagatcgcattggctttatctttttttatgataactcatagttattat
gcgttttcgcaagatgaaattaagaagaataatcctacgttagaaaaaaagcccatcgtc
ctcatgaagcatgaaattcaagaaaaaaaaacccttgccgcctttacctcctttgcatcg
taa

DBGET integrated database retrieval system