KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_03135Help
Entry
CLIBASIA_03135    CDS       T00948                                 

Definition
(GenBank) peptidase S16 lon domain protein
  KO
K07157  uncharacterized protein
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    CLIBASIA_03135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LON_substr_bdg
Motif
Other DBs
NCBI-ProteinID: ACT57213
UniProt: C6XFR0
Position
531385..532050
Genome map
AA seq 221 aa AA seqDB search
MKIGNTIYKNREDLPCLLPIFPLLGMLLLPGSRFSFSVFERRYIAMFDSVLAGDRLIGLV
QPAISGFLANSDNGLSQIGCIGRITSFVETDDGHYIMTVIGVCRFRLLEEAYQLNSWRCF
YIAPFISDLAGNDNDGVDRVALLEVFRNYLTVNNLDADWESIEEASNEILVNSLAMLSPF
SEEEKQALLEAPDFRARAQTLIAIMKIVLARAYTHCENRLQ
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggtaatacaatatacaaaaatcgtgaagacttaccgtgtttattgccgatt
ttccctcttttaggtatgttgttattgccgggcagtcgcttttcttttagcgtttttgaa
cggcggtatattgctatgtttgattctgtattagcaggggatagattaatagggttagtt
cagccagcaatcagtggttttcttgcgaatagtgataatggtttgtctcaaattggttgt
attggtcgtatcacgtcttttgtggaaacagatgacggtcattatattatgactgtaatc
ggtgtttgtcgattccgattgctagaggaagcctatcagttaaactcttggcgttgtttt
tatattgctccatttatatcggatcttgcgggaaatgataacgatggtgttgatagggtc
gctttgttagaagtgtttcgcaattatttaacggtgaataatttggatgccgattgggaa
agtattgaggaagctagtaatgagatattggttaattcacttgcgatgctttctcctttt
agtgaagaggaaaaacaagccttactagaagctcctgattttagagctcgtgcacagact
ttgattgcaattatgaaaattgtacttgctcgcgcgtatactcattgtgaaaataggttg
caatag

DBGET integrated database retrieval system