KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_03185Help
Entry
CLIBASIA_03185    CDS       T00948                                 

Gene name
mutS
Definition
(GenBank) DNA mismatch repair protein
  KO
K03555  DNA mismatch repair protein MutS
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    CLIBASIA_03185 (mutS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:las03400]
    CLIBASIA_03185 (mutS)
DNA repair and recombination proteins [BR:las03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     CLIBASIA_03185 (mutS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MutS_V MutS_I MutS_III MutS_II MutS_IV
Motif
Other DBs
NCBI-ProteinID: ACT57223
UniProt: C6XFS0
Position
complement(520299..523061)
Genome map
AA seq 920 aa AA seqDB search
MTKEFSSPQKLYSEQIDLEENLKSSTPMMRQYIEIKSINPDSLVFYRMGDFYELFFDDAL
LASRCLGITLTKRGKHLGKDIPMCGVPVHTANHYIQKLIKIGHRIAICEQIESPLEAKKR
GNKSLVRRNVVRLVTPGTLTEDQLLSPTDSNYLMAVARIRTEWAIAWIDISTGIFKISTS
NHDRLISDIMRIDPREIIFSEKELSHAEYKSLFETLGNVAVAQPNVFFDHSISESRIADY
YNITTVDTFGSFSQVEKTAAAAAISYIKKTQMVNKPTIGYPEREDIQSTLFIDSAARSNL
EILRTLSGSREQSLLKTIDYSITGAGGRLFAERIASPLTDSTKINTRLDSINFFIQNPIL
INPIQKILKSSPDVPRSLSRLKIGRGEPKDIAVIRDGIRSGINILNLFLKNDLPEELRGA
VEKLKKLPQSLEKTLSSMLSDDLPTFKRDGGFLRDGADASLDETRSLRDQSKRIIASLQL
KYAEETKIKNLKIKHNNNLGYFIEVTSSSASVLKKDLESKDRFIHRQTMSNLTRFTTLEL
IDLENRITNATNSALLIELESFEILSNAIIEQSESLDNASQVIAIIDISIALAILAKEQN
YCRPIIDNSTNFIVKDGRHPIVEKTLKQQSSKPFIANDCDLSCPNDKNSGKLWLLTGPNM
GGKSTFLRQNALIVIMAQMGSYVPASYAHIGIVDKLFSRVGSADNLASGRSTFMVEMIET
ASILNQATNQSFVILDEIGRGTATLDGLSIAWATIEYLHETNRCRGLLATHFHELTDLSK
SLKRFHNATLQVSDSNEGIIFLHKVIPGIADHSYGIQVGKLAGLPNTVISRAYDILKTFE
KLYHHNQKDMRLYYPEIQTKESKNNLSKNDKLFVEKIKCLNLDEMSPLTALKTLYAVKAW
TLEKYSTDEDSEPLSSKQEN
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagagttttcatctcctcaaaaattgtactctgaacaaattgatctagaagaa
aacttgaagtcttcgactcctatgatgcgtcaatatatcgaaataaaatctattaatccc
gatagtttagtattttataggatgggagacttttatgaattgttttttgatgacgctctc
ctagcatctcgttgccttggaattaccttaaccaaaagaggaaaacacctaggaaaagat
attccgatgtgtggagttccagtacatactgcaaaccactatattcaaaagctcataaaa
ataggacatcgaatcgctatatgtgaacaaattgaatctcctcttgaagcaaaaaaacgc
gggaataaatctttagtacgccgcaatgtagttcgtcttgtaacgcctggaacgcttacc
gaagatcagttactttctccaacagattctaattatctcatggcagtcgcccgtattcgg
acagaatgggccattgcatggattgatatctcaacaggaatttttaaaatatcaacgtca
aatcacgatagattaatttcagatatcatgcgcattgatccacgggaaattatcttctct
gaaaaagaactgtcgcatgctgaatacaagtcactttttgaaacgttagggaatgtagct
gtagcacaaccaaatgtgtttttcgatcattccatttctgaaagtcgtattgccgactac
tataacataacaaccgttgatacttttggttctttctctcaagtcgaaaagacagcagcg
gcagcagccatttcttacatcaaaaaaacacagatggtaaataagccaactattggatat
cctgaacgagaagatatacaatctacattgttcatcgactctgctgctcgttctaattta
gagattctacgcactctttcaggatctcgcgaacaatctctgttaaaaaccattgattat
agtatcacaggagctggaggaagactttttgctgagagaattgcatcacctttgactgat
tctacaaaaatcaatactcgtctcgattcaattaatttttttattcaaaacccaatatta
atcaatcctatacagaagatactaaaatcttctcctgatgtaccacgatctctttctcgt
ctcaaaatcgggcgaggagaaccaaaagatattgctgtcattcgcgatggtatacgctct
ggaataaatattttaaatctcttcttaaaaaatgatctaccagaagagttgcgaggcgct
gtagaaaaattaaaaaaattacctcaatctctggaaaaaacactgtcatcaatgttatct
gacgacttaccaacctttaaaagagacggaggatttttacgcgatggagcggatgcatct
ttagacgaaacgcgatcactacgtgatcaatccaaacgtattatcgcatctctacagttg
aagtacgcagaagaaacaaaaattaagaatctgaaaattaaacataacaataatttagga
tacttcattgaagtcacctccagtagtgcaagcgttttaaaaaaagacttagaatctaaa
gatcgctttatacatcgacaaactatgtccaatttaactcgctttactactctcgaactt
attgatctagaaaatcgtattactaatgctacaaatagcgctttattaattgaactagaa
tcttttgagattctctctaatgctataatcgagcaatcagaatcactcgataatgcctca
caggtgatagctatcattgatatctctattgctttggcaatattagctaaagaacaaaat
tattgtcgtcctatcatcgataattcaacaaattttattgtaaaagatggtcgtcatcct
attgttgaaaaaacattaaaacagcaatcatcaaagccttttatagcaaatgattgtgat
ctgtcctgccctaatgacaaaaattctggaaaactttggctccttacaggacctaatatg
ggaggtaaatccacttttctacgtcaaaatgctctcattgtaatcatggcgcaaatggga
tcttatgttccggcatcttatgcccatattggtatagtagataaattattttcacgcgtt
ggttctgcggataatttagcaagtggacgctccactttcatggtggaaatgattgaaaca
gcatcaattttaaatcaagcaaccaatcaatcatttgttattttagatgagattggaaga
ggaactgccacgttagatggactgtctatagcatgggctactatagaatatttacacgaa
accaatcgttgccgtgggttattagcaacccatttccatgagttaacagatttatcaaag
agcttaaaaagatttcataatgctactttacaagttagcgacagcaatgaaggaataatt
tttttgcacaaagtcattccaggcatcgctgatcattcttatggaatacaagtaggaaaa
ttagcaggactacctaatacagttatatcacgagcgtatgacattttaaaaacattcgaa
aagctatatcatcataatcaaaaagatatgcgactatattatccagaaattcaaacaaaa
gaatcgaaaaataacctatcaaaaaatgacaaactgttcgtcgaaaaaataaaatgtctg
aatcttgatgaaatgtctccattaacagcattgaaaaccttatacgctgtaaaggcatgg
actttagaaaaatattccacagatgaagactcagaaccgctttcttcaaaacaagaaaat
taa

DBGET integrated database retrieval system