KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_03200Help
Entry
CLIBASIA_03200    CDS       T00948                                 

Gene name
prfB
Definition
(GenBank) peptide chain release factor 2
  KO
K02836  peptide chain release factor 2
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:las03012]
    CLIBASIA_03200 (prfB)
Translation factors [BR:las03012]
 Prokaryotic type
  Release factors
   CLIBASIA_03200 (prfB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCRF RF-1
Motif
Other DBs
NCBI-ProteinID: ACT57226
UniProt: C6XFS3
Position
complement(513525..514592)
Genome map
AA seq 355 aa AA seqDB search
MKLSRQLNCLGGLFDWDNAVQRLSFLNTKTEDPHLWQNVIEAKMLMRERQHLDNAISFIK
EIQDRLCDNLILLELALEEDDCSILQETSDNLQRIKLEVEYKQFESLLSGEADSNDAYLE
VHAGAGGTESQDWANMLLRMYTRWAEKRKFKTEALEIHDGEEAGIKSATLLIKGPNAYGW
LKGEQGVHRLVRISPYDSNSRRHTSFSSIWVYPVVDDSIEIEISESDCRIDTYRASGAGG
QHVNTTDSAVRITHIPTGVVVQCQQERSQHKNKAQAWNMLRAKLYELELQKREEIANIGE
SSKTEIGWGRQIRSYVLQPYQMVKDLRTNIEKTSPSDVLDGDLDDFMKATLAIKK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagcaggcaattgaactgcttaggaggtctctttgactgggataatgcagta
caacgcttaagttttttgaataccaaaactgaagatcctcatttatggcaaaatgtaata
gaagccaaaatgttaatgcgcgaacgtcaacatctagataatgcgatttcttttataaaa
gaaatccaagatcgactttgtgataatctcatactcttagaacttgccttagaagaagac
gattgttctatattacaagaaacttcagacaacctccaaagaatcaaattagaagtagaa
tacaaacaatttgaaagccttctatctggcgaagcagattctaatgatgcttatcttgaa
gtgcatgctggggcaggaggaacagaaagccaagattgggcaaatatgttactacgaatg
tatactcgatgggctgaaaagcgaaaattcaagacagaagctctagaaattcacgatgga
gaagaagctggaattaaatcagctacgttattaatcaaaggacctaacgcttatggatgg
ctaaaaggagaacaaggagtccataggctagtccgaatttcaccttatgatagcaattcc
cgtcgtcatacttctttctcttcaatatgggtatacccagttgtggacgattcaattgaa
atagaaataagtgaaagtgactgtcgcattgatacgtatagggcttctggagcgggtgga
cagcacgtcaacacaacagattcggctgtacgcattacacatattccaacaggcgtagtg
gttcagtgtcaacaagagcgctctcaacacaaaaataaagctcaagcttggaacatgttg
agagccaaactctatgaacttgaattacaaaaacgcgaagaaatagcaaatattggagaa
tcatcaaagacagaaattggatggggacgacaaatccggtcatatgtattgcaaccatat
caaatggtcaaggatttacgtacgaatatagaaaaaacttcaccttcggatgtccttgat
ggagatttagatgatttcatgaaagcgacgctagcaatcaaaaaataa

DBGET integrated database retrieval system