KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_03215Help
Entry
CLIBASIA_03215    CDS       T00948                                 

Definition
(GenBank) methyltransferase protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_25 Methyltransf_16 Cons_hypoth95 UPF0020 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: ACT57229
UniProt: C6XFS6
Position
complement(510535..511212)
Genome map
AA seq 225 aa AA seqDB search
MILASLVNATGSFHLADLGAGAGAAGLAVASRLHEAQILLAERSPLMAHYARKTLALPAN
AQISKRISLIEVDVTLVGENRNLAGLKNNFYDHVIMNPPFNERIGTMTPDKIKEEAHVML
EDSFEKWIRTACAIMRSSGQLSLIARPQSLIQIVNACARRIGSLEITPLHPREGECASRI
LVTGRKGMRGQLRFRYPIVLHKPNGQPYSRFVTDLINGKRSLTRL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgatcctagcatccttagtgaacgctacaggctcctttcatctagcagatcttggagca
ggtgcaggcgcggctggactagccgtcgcctctagattacatgaagcacaaattctatta
gctgaacgatccccattaatggcccattacgcacgtaaaactttggcattacctgctaat
gcacaaatttctaagcgcatttcccttatcgaagtagacgttacattagtcggagaaaat
cgtaatttagctggattaaaaaataatttttatgaccatgttatcatgaacccgcctttc
aatgaaagaattggaactatgactcccgacaaaataaaagaagaagcacacgtaatgtta
gaagattccttcgaaaaatggatccgcactgcttgtgctataatgcgatccagtggacaa
ttatcattaattgcacgaccccaatcactgatacagattgtcaacgcttgtgcaagacgc
atcggatccctagaaatcactcctcttcatcctcgagaaggagaatgtgcttcccgtatt
ctagtgacaggtcgcaaaggcatgcgcggacaattaagatttcgctaccctatcgttctc
cataaacctaatggtcaaccttattcacgttttgtcactgatctcattaatggaaaaaga
tccttaacacgtttataa

DBGET integrated database retrieval system