KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_03225Help
Entry
CLIBASIA_03225    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
  KO
K01069  hydroxyacylglutathione hydrolase [EC:3.1.2.6]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00620  Pyruvate metabolism
las01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLIBASIA_03225
Enzymes [BR:las01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.6  hydroxyacylglutathione hydrolase
     CLIBASIA_03225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B Lactamase_B_2 PDEase_II
Motif
Other DBs
NCBI-ProteinID: ACT57231
UniProt: C6XFS8
Position
complement(508500..509150)
Genome map
AA seq 216 aa AA seqDB search
MSKLSFHIVQVTPFKQNCTFLFDEESLEAVVVDPGGDLDIIKDVIQSRNFHVKQIWITHG
HVDHVGGAAQLKEDLSLTIIGPHKDDAAMMGKVDEQARLLSIRMNARNASSDRWLQDGDT
LLLGTHIFKVFHCPGHSPGHVIYVNFENNFAHLGDTLFRSSIGRTDILHGDYQQLINSIN
NKILPLGDEISFVCGHGPNSTIGRERRLNPFLKSNI
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaattatcttttcatattgtacaggtcactcctttcaaacaaaattgtactttc
ctatttgatgaagagagtttagaagctgttgttgtggatcctggtggcgatcttgatatc
ataaaagatgtcattcaatctcgtaatttccatgtcaaacaaatttggattacccatgga
catgttgatcatgtaggaggagctgcacaattaaaagaagatttatctttaacaattata
ggtcctcacaaagatgatgcggcgatgatgggaaaagtagacgaacaagctagattacta
tcaatccgtatgaatgcacgcaatgcttcatcagatcgatggttgcaagatggagatact
ttactacttggtacacatatttttaaagtgtttcactgtccaggccattcacctggtcac
gtcatttacgtcaattttgaaaataattttgctcatttaggagatacattatttagaagt
agtattggaagaaccgatattctccacggagattaccagcaattaataaactcaatcaat
aataaaatactacccttaggagatgaaatatcctttgtttgtgggcatggtcctaacagc
actatagggagagaacgccgtttaaatccttttttaaaatcgaatatataa

DBGET integrated database retrieval system