KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_03290Help
Entry
CLIBASIA_03290    CDS       T00948                                 

Gene name
lpxB
Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00540  Lipopolysaccharide biosynthesis
las01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CLIBASIA_03290 (lpxB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:las01003]
    CLIBASIA_03290 (lpxB)
   01005 Lipopolysaccharide biosynthesis proteins [BR:las01005]
    CLIBASIA_03290 (lpxB)
Enzymes [BR:las01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     CLIBASIA_03290 (lpxB)
Glycosyltransferases [BR:las01003]
 Polysaccharide
  Bacterial polysaccharide
   CLIBASIA_03290 (lpxB)
Lipopolysaccharide biosynthesis proteins [BR:las01005]
 Lipid A
  CLIBASIA_03290 (lpxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB DUF354
Motif
Other DBs
NCBI-ProteinID: ACT57240
UniProt: C6XFT7
Position
494980..496131
Genome map
AA seq 383 aa AA seqDB search
MNSLKIAVIAGEISGDLLAGDLIKSLKEMVSYPINLVGVGGPSLQKEGLVSLFDFSELSV
IGIMQVVRHLPQFIFRINQTVELIVSSKPDVLLIVDNPDFTHRVAKRVRKKMPNLPIINY
VCPSVWAWREGRARKMCAYINQVISILPFEKEVMQRLGGPPTTFVGHPLSSSPSILEVYS
QRNKQRNTPSQWKKILLLPGSRAQEIYKILPFFESAVASLVKRNPFFRFSLVTVSSQENL
VRCIVSKWDISPEIIIDKEQKKQVFMTCNAAMAASGTVILELALCGIPVVSIYKSEWIVN
FFIFYIKTWTCALPNLIVDYPLVPEYFNSMIRSEALVRWIERLSQDTLQRRAMLHGFENL
WDRMNTKKPAGHMAAEIVLQVLG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaattcacttaagattgctgttattgctggtgagatatcaggagatcttcttgctggt
gatctgataaagtctctcaaagagatggtaagttatcctatcaatttagtaggggttggt
ggtccttctttgcaaaaagaagggcttgtttctttgtttgatttttctgaattatcagta
attggaattatgcaagttgttagacatttacctcagtttatttttcgtattaatcagacc
gtagaattaattgtttcttctaaaccggatgtcttattgattgttgataatcctgatttt
acgcaccgtgtggcaaaacgtgttcgcaaaaaaatgccaaatcttccaataattaattac
gtttgtccaagtgtttgggcatggcgtgaaggacgtgcacgtaaaatgtgtgcgtatatt
aatcaggttatatctattcttccttttgaaaaagaagttatgcagaggttaggcggacct
cctactacattcgtaggtcatcctttgagtagtagtccttcgatattagaagtatatagt
cagagaaacaaacaacgaaatactccttctcaatggaaaaagatacttttgttgcctgga
tcacgtgctcaagagatttataaaattttgcctttttttgaaagtgctgtagcatctctt
gttaaacgaaatcctttttttagattttcattagtgacagtatcatcgcaagaaaatctt
gtgcgttgtatagtctcgaaatgggatatatctcctgagattattattgataaagaacag
aaaaaacaagtgtttatgacatgtaatgctgcaatggctgcatctggaacagttattttg
gagttagcactatgtggcattcctgttgtttctatttataaatcagagtggattgtgaat
ttttttattttttatataaagacatggacttgtgctttgcctaatcttattgttgattat
cctttagtccctgagtatttcaatagtatgattcgttcggaggcattggtgcgttggatt
gaaaggttatctcaggatactttgcaacggcgtgctatgttacatggttttgaaaatttg
tgggatcgtatgaatacaaagaagccagcaggtcacatggcggcagaaatagtgcttcaa
gtattaggttag

DBGET integrated database retrieval system