KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_03305Help
Entry
CLIBASIA_03305    CDS       T00948                                 

Gene name
fabZ
Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00061  Fatty acid biosynthesis
las00780  Biotin metabolism
las01100  Metabolic pathways
las01212  Fatty acid metabolism
Module
las_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CLIBASIA_03305 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CLIBASIA_03305 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:las01004]
    CLIBASIA_03305 (fabZ)
Enzymes [BR:las01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CLIBASIA_03305 (fabZ)
Lipid biosynthesis proteins [BR:las01004]
 Fatty acid synthase
  Component type
   CLIBASIA_03305 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT DUF4886
Motif
Other DBs
NCBI-ProteinID: ACT57243
UniProt: C6XFU0
Structure
PDB: 

Position
492845..493330
Genome map
AA seq 161 aa AA seqDB search
MISDLACLDAKDIVELMRFLPHRYPFLLVDKVVNIQRDESAIGIKNVTFNEPHFMGHFPG
RPVMPGVLILEGMAQTAGAICAIHNGFDQYAPPYLMSIDKARFRKPVFPGDRLEYHVNKV
RNRVDLWKFQCCAKVENTVVAEAEICAMVMHEKKEKNESHG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtgatcttgcatgcttagatgcaaaagatattgttgaattaatgcggtttttg
ccccataggtatccttttttgcttgtggataaggtagtgaatatccaacgggacgaatcc
gcgataggaatcaagaatgttacgtttaatgaacctcattttatgggtcatttcccaggg
aggcctgttatgccaggtgttcttattcttgagggtatggcgcaaacagcaggtgctata
tgtgcaattcataatggtttcgatcagtatgcgccaccatacttgatgtcaattgataaa
gcgcgttttcgcaaaccagttttccctggagatcgtttagaatatcatgtaaataaagtc
cgcaatcgtgttgatctttggaagtttcagtgttgcgcaaaagtggaaaatactgttgtc
gctgaagcggagatttgtgccatggttatgcatgagaaaaaagagaaaaatgagtcgcat
gggtaa

DBGET integrated database retrieval system