KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_03350Help
Entry
CLIBASIA_03350    CDS       T00948                                 

Gene name
rpsB
Definition
(GenBank) 30S ribosomal protein S2
  KO
K02967  small subunit ribosomal protein S2
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las03010  Ribosome
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CLIBASIA_03350 (rpsB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:las03011]
    CLIBASIA_03350 (rpsB)
Ribosome [BR:las03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    CLIBASIA_03350 (rpsB)
  Bacteria
    CLIBASIA_03350 (rpsB)
  Archaea
    CLIBASIA_03350 (rpsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S2 BCL9
Motif
Other DBs
NCBI-ProteinID: ACT57252
UniProt: C6XFU9
Position
483518..484354
Genome map
AA seq 278 aa AA seqDB search
MALPQFTIRQLLESGVQFGHRNFLWNPKMERYIFCERNNTHIIDLSQTVPMLQKALQVIS
DTVARGGRILFVATKSQASDCVMEAAKRSAQYCVNSKWLGGMMTNWKTVSQSIQKLRDLE
ELLNKENQGFTKKERLNIERKRDKLKRALDGIRDMGGLPDLMFVVDTNREKLAIQEARRL
RIPIVAVVDTNSNPDLVDYVIPGNDDSSRSIALFCDLVASAAIDGIARQHSYMGADTKSA
GETVVHSKEGMQLEEDSQSSESSVLDGQEVAVVPELMS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggctcttccacaatttaccatacgacagctcttagagagtggagtacaatttggtcat
cggaattttttatggaatccgaagatggaacgttacattttttgtgagcggaataacact
cacattatagatctttctcaaacagttcctatgttgcagaaggcgttgcaagttatttct
gatactgttgcacgaggcggccgtattttatttgtagctacgaagtcacaagcttctgat
tgtgtcatggaagctgccaaacgttctgcgcagtattgtgtaaattctaagtggttaggt
ggtatgatgaccaactggaaaactgtttctcaatctattcagaaattgcgagatttagag
gagctcctcaataaggaaaaccaagggtttactaagaaagaacgtttaaatatcgaacgt
aagcgtgataagctcaaaagagctctagatggtatccgtgatatgggtggattgcctgat
ttaatgtttgttgttgacaccaatcgggagaagcttgctatccaagaggctcgtcgcttg
cgcatacccatagtagcagtggttgatactaatagcaatcctgacttggtggattatgtc
ataccaggaaatgacgattcctctcgctctattgcgctgttttgcgatcttgttgcatcg
gcagctattgatggtattgcacgacagcatagttatatgggtgcagatacaaagtctgca
ggtgaaactgtggttcattcaaaagagggtatgcagctggaagaggattcacaatcttcc
gaaagttcggtgcttgatggtcaagaggtggctgttgttcctgaattgatgagttga

DBGET integrated database retrieval system