KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_03405Help
Entry
CLIBASIA_03405    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GtrA SPC25
Motif
Other DBs
NCBI-ProteinID: ACT57263
UniProt: C6XFW0
Position
470431..470820
Genome map
AA seq 129 aa AA seqDB search
MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR
RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM
TRRVYFIKK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcaatgtattatttttattatcaatatcgttgttgttttttttatagatgtgatg
ggattttttatattgatgaaatgtggagctgatccattttatagtaggatattttctatc
gcagtagcgtttttagtgacttggataccaagccgtttgtttatatttcttaaattgcgg
cgtaagtcttttcttgaaacagttcgttatggggtcatgtattttatgttatccatccta
aattacgctttttacgtaaaattattactaacttttcagggtttacaaccgttattagcg
actgttttatccgcagtgtcttcaatgttatttgtttttttactgtatattcgctttatg
actagaagagtttattttatcaaaaaataa

DBGET integrated database retrieval system