KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_03460Help
Entry
CLIBASIA_03460    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
  KO
K06997  PLP dependent protein
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    CLIBASIA_03460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N
Motif
Other DBs
NCBI-ProteinID: ACT57274
UniProt: C6XFX1
Position
455896..456564
Genome map
AA seq 222 aa AA seqDB search
MSLGNKLQVFKQKIENSAILAKRPKDSVSLVAVSKMVDSKKIRVALSCGQVIFAENKLQE
AKKKWIPLRKEWDVQLRFIGSLQSNKVSEIVSLFDVIETVSREKTASLLSLEMIKQSRFL
PVYIQVNTGYEIQKSGIMPNQTKDFVILCRQKYQLNVEGLMCIPPAMGNPKPHFYLLSEI
ARECKLTKLSMGMTRDFELAIASGATSVRIGSGIFGERPCQT
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgggaaacaaattacaggtttttaagcaaaagatcgagaatagcgcgatactt
gcaaaacgtccaaaggacagtgtgtctttggtagctgtttcaaaaatggttgatagtaaa
aagattagggttgctttgtcttgtggacaagtgatctttgccgagaataagttgcaagaa
gcaaaaaaaaaatggattcctttgcgaaaggaatgggatgtacaattgagattcattggt
tctttgcaatctaataaagtatccgagattgtttctctttttgatgttattgagacagtt
agtcgagaaaagacagcttctttattatcccttgaaatgatcaaacaaagtcgtttttta
cctgtttatattcaggtgaatacgggatatgagatacaaaaatctggaataatgcctaac
cagacaaaagattttgttattttatgtcgacaaaaatatcaacttaatgtcgaaggctta
atgtgtattcctcctgccatgggtaatcctaaacctcatttttatttattatctgaaatc
gctagagagtgtaaactcacgaagttatctatgggaatgacgagagactttgagctagct
attgcatctggtgccactagtgtccgaataggttctggcatatttggagaacgtccatgt
caaacatag

DBGET integrated database retrieval system