KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_03665Help
Entry
CLIBASIA_03665    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5434
Motif
Other DBs
NCBI-ProteinID: ACT57311
UniProt: C6XG08
Position
808801..809112
Genome map
AA seq 103 aa AA seqDB search
MNSLLFGFLAFLYAYGGSVVFSLFESFFVEKEDGELFIRIMVFEISWSRGEFYVDLLPFN
FASRSSYQQRSNILSHRKEIAIDQRRTPITQKLSMGNLSELQE
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgaattcactcttgtttggttttttggcctttctgtatgcgtatggtggatcagtcgtt
tttagcttgtttgaatccttcttcgttgagaaagaagatggcgaacttttcatcaggata
atggtttttgaaatcagttggagtaggggagaattctatgtagacctcttgccattcaat
ttcgccagtcgttcgtcgtatcaacaacgcagcaatatccttagccataggaaagagatt
gcaatagatcagagaagaactcccattacacaaaaacttagtatggggaatttatcggag
ttacaggagtaa

DBGET integrated database retrieval system