KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_03810Help
Entry
CLIBASIA_03810    CDS       T00948                                 

Gene name
nuoN
Definition
(GenBank) NADH dehydrogenase subunit N
  KO
K00343  NADH-quinone oxidoreductase subunit N [EC:7.1.1.2]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00190  Oxidative phosphorylation
las01100  Metabolic pathways
Module
las_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CLIBASIA_03810 (nuoN)
Enzymes [BR:las01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     CLIBASIA_03810 (nuoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proton_antipo_M
Motif
Other DBs
NCBI-ProteinID: ACT57340
UniProt: C6XG37
Position
835727..837163
Genome map
AA seq 478 aa AA seqDB search
MSPVSFINDLRLCIPEIIIAFGILFLLLMGVFSRRKNAFHLVVFPVCLLSIALFFLLIMP
YEGIGLGGAYISDRFSYFIKAILLMSSIIIFIKMFSCIYVKPFSCFEFPVIMLMAVLGML
CMISANDMISFYMSLELQSFALYVLIAMNRKSVFSIEAALKYFVLGAFSSAFLLYGISFI
YGFTGCTGFSQIATSLFIGHRSFVLIVGVVLILVGLFFKMALVPFHMWIPDVYEGSPMFM
TAFLATIPKFATTMALCRITSVFWPMLSGLLPIFMCVSIGSMVLGSVVAIRQKDLKRLMA
YSSIGHAGYALIGFSTGMLGIVAMVRYMVIYLIMMIGFFSCILSLRRKDGNNIQNISDLA
GLSRQDIFLTCALTIFLFSLAGIPPFAGFFGKYFLLISAVKREFYVLAIVALLSSVISAY
YYLRVISIMWFDQSTECVVVVAKEMRLFIFGSILFVTGYFLIENILNSSIMKIVMSLF
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagtcctgtaagttttataaatgatttgcgtctttgcatccctgagataattattgct
tttggcattctctttcttcttttaatgggtgttttttcgcgtcggaaaaatgcctttcac
ttagttgtttttccagtatgtttattaagcattgccttatttttccttcttattatgcct
tatgaaggaataggtttagggggagcttatatttcggatcgcttttcatattttatcaaa
gcgattcttttgatgagtagcatcattatttttattaagatgtttagttgtatttatgta
aaaccttttagttgttttgaattccctgttatcatgttgatggctgttttgggtatgctt
tgtatgatttcagccaatgatatgatatccttctacatgtcgctcgaattgcaatctttt
gcgctttatgtgcttattgctatgaatcggaagagtgttttttctattgaagccgctctt
aaatattttgtattaggagctttttcttctgcttttttattatatgggatctctttcatt
tatggatttacgggttgcacaggtttttcacaaatagcgacgtctttgtttattgggcat
aggtcttttgttctgattgttggagtagtgctaattctagtaggtcttttctttaaaatg
gcattagttccatttcatatgtggatacctgatgtttatgaagggtcgcctatgtttatg
actgcttttttagcaactatcccaaagtttgctacgacgatggctctttgtcgcatcacc
agtgttttttggcccatgctttctggcttattgcctatttttatgtgtgtttctattggt
tcaatggtattgggttccgttgttgcaatcagacaaaaggatttaaaacgtcttatggct
tattcctctataggtcatgcgggctatgctttgatcggtttttccactggtatgcttggt
attgttgccatggttagatatatggttatttatctgattatgatgatcggatttttttct
tgtattttatctttgcgtcgtaaagatggaaataatattcagaatatttctgatcttgcg
ggtttatcacgacaagatattttcttgacctgtgccttgactatttttcttttttctttg
gcaggtattccgccttttgcaggtttctttggtaagtattttcttctcatttctgctgta
aaaagagaattttatgttttagctattgtcgccctactgtcttctgtgatatctgcttat
tattatttgcgtgtcatcagtatcatgtggtttgatcagtcaacagaatgtgtcgtggtc
gtcgcaaaagaaatgagactgtttatttttggatctatcttattcgtcactggttatttc
ttaattgaaaatatcttgaattcttcgattatgaagatagttatgtctttgttttaa

DBGET integrated database retrieval system