KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_03815Help
Entry
CLIBASIA_03815    CDS       T00948                                 

Definition
(GenBank) birA bifunctional protein
  KO
K03524  BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00780  Biotin metabolism
las01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CLIBASIA_03815
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:las03000]
    CLIBASIA_03815
Enzymes [BR:las01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     CLIBASIA_03815
Transcription factors [BR:las03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    CLIBASIA_03815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C
Motif
Other DBs
NCBI-ProteinID: ACT57341
UniProt: C6XG38
Position
837166..837924
Genome map
AA seq 252 aa AA seqDB search
MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI
SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK
IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV
ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG
CVRQIFTGDIFT
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgttttctaatcttagtgaatgtcaaaatccttatagttttcgatatgaattctttgat
actatttcttctactaatgatgaatgtatgaaacgtgcgttatctggagatttgggaaat
ttgtggatcgttgcgtcttgtcaaacggctggtcgaggtcgtagggataataaatggatt
tctgataagggcaatctctatgcctcgttgttattgattgattctatatcaaaagattcc
ctaacgctcttatcatttgctattgctgttgctatgcgttcagttatagcatctacactt
cctgttggaacagatgttaaaataaaatggcccaatgatatactagtctttcaacgtaaa
attgctggcatattaattgagactctaaatttaaaaaatggtttacaagcagttgtcgtt
ggaataggattgaacgtaaagcattgtcctgtagacaccccttatcctgttacatctttg
cagagagaaggaggatgcatcgatttaaaggatattttttcccttttatttcaagatgtt
gcgagggtattagacctttggaaaaaagatacgggacgagaagaaattatgaatctctgg
cgttgttttgcgtgtggtataggtgatcttattacgattaaactatcatatggttccatt
ttaggtcgttttgttggagtcgacgatttcggatatctattattagaagaaaaaaaagga
tgtgttcgtcagatttttacaggagatatttttacttag

DBGET integrated database retrieval system