KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_03965Help
Entry
CLIBASIA_03965    CDS       T00948                                 

Definition
(GenBank) ABC transporter membrane spanning protein (branched chain amino acid)
  KO
K01998  branched-chain amino acid transport system permease protein
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las02010  ABC transporters
las02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:las00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CLIBASIA_03965
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CLIBASIA_03965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:las02000]
    CLIBASIA_03965
Transporters [BR:las02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    CLIBASIA_03965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: ACT57369
UniProt: C6XG66
Position
871008..872063
Genome map
AA seq 351 aa AA seqDB search
MSIFSLRLNKYDKILCLLAVVYPLLLFLFLGATKSQKYIDSMGIQILIYVMFAWGLSIVV
GSLGLLSLNCVIAYAIGAYSYVILGSRYGLSIWLLIPVSAMISGACGMIMGLPSLKFRGD
YLAIATLIMSEIFQNILIKWKPITNGKAGIYVADRLYFLGTTVRSLIRFFRFPSSFVIYE
IFMYYVLLGMCFLSASIILWLRRTAISNAWRTIRDNQKAFFSLNTTIIFAKLSAFAVSSA
FIGMAGAFFAASRDRISPDMFKFSENIIVISIVILGGMTSLSKIAKATAILIGVVELCCG
MNFYYFNSLLKFDCSFNMRHTTLMVIALFLVILMRSHSLLRLRTPSNFLER
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatattttccctaagattgaataaatacgataagattttatgtcttctagctgtg
gtatacccccttctactttttctcttccttggtgctactaaatctcaaaagtatatagat
agcatgggaattcagattcttatatatgtgatgtttgcttggggtttaagcatcgtcgta
ggatctttaggattgttgagtcttaattgcgttattgcctatgcaataggagcatattct
tacgttatattagggagtcgttacggtttatccatatggttattgatacctgtatctgct
atgatttctggtgcatgtggtatgataatgggtttgccttctcttaagtttcgaggagac
tatttggctattgcgacattgattatgtcggaaatttttcaaaatattttaataaaatgg
aagccaataactaatggaaaagcagggatttatgttgctgatcgtttatattttttggga
acaactgttagatcgttgatacgttttttccgatttccttcttcctttgttatttatgaa
atatttatgtactacgttctcttaggtatgtgttttttatcggcatcgataattttgtgg
ttacgtcgtacagctatcagcaatgcttggagaacgattagggataatcaaaaagccttt
ttttctctcaatacaacaatcatttttgcgaaattatccgcatttgctgtgagttctgcg
tttatagggatggctggagctttttttgctgcatcacgagatagaatatctcctgatatg
tttaaattctctgagaatataatcgttatatctattgttatccttgggggtatgacctcc
ctttctaaaattgctaaggctaccgcaattcttatcggtgtagtagagctttgttgtgga
atgaatttctattatttcaattcattactgaaatttgattgctcgtttaatatgcgtcac
actactttgatggttattgctttgtttttagttatattaatgagatctcattctttgctt
aggttgcgtactccttcaaatttcttagaaaggtaa

DBGET integrated database retrieval system