KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_03990Help
Entry
CLIBASIA_03990    CDS       T00948                                 

Gene name
map
Definition
(GenBank) methionine aminopeptidase
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:las01002]
    CLIBASIA_03990 (map)
Enzymes [BR:las01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     CLIBASIA_03990 (map)
Peptidases [BR:las01002]
 Metallo Peptidases
  Family M24
   CLIBASIA_03990 (map)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M24
Motif
Other DBs
NCBI-ProteinID: ACT57372
UniProt: C6XG69
Position
complement(875572..876393)
Genome map
AA seq 273 aa AA seqDB search
MLSSSSRESGSINIYTPEELENIRSACNVVARCLDSLTPIIKPGTTTEEIDDFVLKFGME
NNAIPATLNYRGYKKSCCTSINHVICHGIPSNKQLREGDIVNVDVTYVVNGWHGDSSRMY
PVGKIKRAAERILQVTYESLYKGIAAVKLNANIEDIGKAIQRYAHSERYSVVEVFCGHGI
GKSFHEKPEILHFYDPLYPSVGTFQEGMVFTIEPMLNVGGSSAKVLSDGWTAVTRDRSLS
AQYEHTIGITKAGCEIFTLSPNNLGQPGISPIQ
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgctttcttcttcatctagagaatcaggatccatcaatatatatactccagaagaactt
gaaaatatacgtagcgcatgcaacgtagtagcccgttgtttggattccttgacgcccata
ataaaaccagggacgacaactgaagaaatcgatgattttgttctcaaatttggaatggaa
aataacgcaatccctgctactcttaattatcgtggttataaaaaatcatgctgtacatcc
atcaaccatgttatatgccatggaataccctccaataaacaactccgtgagggggatatt
gtcaatgtggacgtgacttacgttgtcaatggttggcacggcgatagcagtcgtatgtat
ccagtaggaaaaataaaaagagcagcagaaaggattctccaagttacgtacgaatctctt
tataagggaattgctgcggttaaattaaatgcaaacatagaagatattggaaaagcaata
cagcgatatgcccacagtgagcgctattctgttgttgaggttttttgtggacacggtata
ggaaaatcctttcatgaaaaaccagaaatcttacacttctacgatcctctttatccttct
gtaggtacatttcaagaaggaatggtattcaccatcgaaccaatgttgaatgtaggggga
tcttctgccaaagtactatccgatggatggactgccgtaacgcgcgatcgctctctatct
gcacaatatgaacacacgatcggcattactaaggcaggatgcgaaatttttacattatct
cccaataacttaggacaaccaggaatttctcctattcaataa

DBGET integrated database retrieval system