KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04010Help
Entry
CLIBASIA_04010    CDS       T00948                                 

Definition
(GenBank) two-component sensor histidine kinase protein
  KO
K07716  two-component system, cell cycle sensor histidine kinase PleC [EC:2.7.13.3]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las02020  Two-component system
Brite
KEGG Orthology (KO) [BR:las00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CLIBASIA_04010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:las01001]
    CLIBASIA_04010
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:las02022]
    CLIBASIA_04010
Enzymes [BR:las01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CLIBASIA_04010
Protein kinases [BR:las01001]
 Histidine kinases
  Cell cycle family [OT]
   CLIBASIA_04010
Two-component system [BR:las02022]
 Cell cycle family
  PleC-PleD [MD:M00511]
   CLIBASIA_04010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS_7 PAS_3 HAUS-augmin3 PAS_9 ERM HATPase_c_3 PAS_8 DivIC
Motif
Other DBs
NCBI-ProteinID: ACT57376
UniProt: C6XG73
Position
complement(881796..884096)
Genome map
AA seq 766 aa AA seqDB search
MENMQNILANYGLYYPGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFL
VFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLL
AKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLD
QQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQA
KKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFR
AIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNI
IGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDH
VLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISV
GTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETAN
KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN
NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRI
IKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLH
NQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatgcaaaatattttagcaaattatggcttatattatccaggaaaccgacaa
aaaatcactgtttcttcaaaacaagcattcaaaagagcgtatacatcaatcatatctcat
ctattctctttcttttcgtcattcaatcaaacaataccgatgattagcatggtatttcta
gtgtttatagctacttctagcattattaaagttacgacaagatatgcacaacaggagaag
atgaccaatcaaacctcccttatgcttacggaagctatagaaattatttttcaaaacaac
aacataaagtttgatctggcatctcaaaaaaaagcagaatcgatgctaggacaacttctt
gccaaaacacgttttctatccgaaagcttcatccttcttgctcaacccaatgaactcgtt
tttgcctcatccacaaaaaattcccattatataggaaagaaaataggagaaataattcct
gagttatctcgctcgagaagtagaagtaaaacggttcaaatgtcagaagcgtctcttgat
caacaaccatatcatgtattatcggtgaaccttccacataatagtggatcgattcttata
atcaattctagagtgccgttattacgtttatggagggaagaagtaacattagaagttgtt
tttttttccatcatttctgcacttcttttgtttatcctctttagttattacagacaggca
aaaaaaaacaaagagaatgatactattttattggaagcgaatatatgtgttgaaacagct
ttatcccgtggtagatgtggcctctggaattttaatttcgacaacaaaaaatttcattta
tcacgatctatgtatgaaattatgggaattccttatgagaataaaaccctatcatttcgt
gcaatagcacgcctcattcattatgataataaaaaaatatgtgaaatagcacgatcagta
accggaaaacatgttaaacagttagatcagatatttcatatgcgacatgcaagcggagca
gatatttggatacaagtacgtgctcagatgatgcgaacaatatcaggaggcatgaatatc
attggcatagcaatggacctgacagagaaatatcacctagaaaaacgctatgcagaagca
gatcagcgattatcaaaagcaatagagtgtacttccgaagccttggttttatgggataaa
aatgaccgactcgtcatgtgtaatgcgaattatcaaaaagcttatggattacctgatcac
gttcttgtaccaggaaatgctcgttcaattattcaagatgcccaaactcgtcccatcatt
gaatatcgcacttccgatcccgaacgttcacaggatatgagtaaagagatcaaacttgcg
gattcaagatggctccaaattaatgaatggtgcacacacgacgggggcactatttccgtc
ggaacggacatcacactccttaaacataatcaagcgcaattacgagaatctaagcgtcgc
ctcaaggcgaccattaatgatctttccacgtcacgtcaaatattagaacgtcaaaaaaca
gaactttcaattgctaatgctaaatatcaagttgaaaaagaacgggctgaaacagcgaat
aaaactaaatcagaatttctcgctaaaatgtctcatgaattacgaactcctcttaatgcc
atcctcggtttttccgaagttatcaaaaaagaaatatttggagaattaggatcggttaaa
tactatgaatatgcccaagatattcattatagcggacaacacctgctgaatatgatcaac
aatattctggaaatgtctaaaatagaaacagagaagatttcgatagataagcaaaatgct
gatttaataccaatcattaatgaaggaattcgattgattggctcttcagcgcagagtaaa
aatatcaaaatcgaaaaaaaaataccttcagaactattttttaatgctgataaacgaatc
ataaagaaaattttatttcctattctctctaattcaatcaaattcaccaacaataatggc
aaaatgatgattagaacctctaaaataggtcaatgtgtgatcataaccattgctgataca
ggcattggtattcctaaatccgctttagaaaaaattgggcaaccctttgaaccattacac
aatcaatatgatcaaagcattggaggatttggacttggactcgctatatctgatgcctta
acgaatctacacggtgggcgattgaaaattatttctcaagaaggaaaaggaacgattgta
acaatttgcatgccacaataa

DBGET integrated database retrieval system