KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04020Help
Entry
CLIBASIA_04020    CDS       T00948                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00471  D-Glutamine and D-glutamate metabolism
las01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CLIBASIA_04020 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:las01011]
    CLIBASIA_04020 (murI)
Enzymes [BR:las01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     CLIBASIA_04020 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:las01011]
 Precursor biosynthesis
  Racemase
   CLIBASIA_04020 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race IceA2
Motif
Other DBs
NCBI-ProteinID: ACT57378
UniProt: C6XG75
Position
885150..885965
Genome map
AA seq 271 aa AA seqDB search
MKIDNYPCEKKLQNSILIFDSGIGGLIVLQKMRFLMPEYHFIYVADDVGFPYGNWEDHAL
KKRLMFLFSDILDKYQPVLSVIACNTAFTLIKDELRSTFPSMAFLGAVPAIKQAAAYTQS
GLISILSTPATLRRTYTSNLIHSYVSQCHIHLVSSMILASRVEEYACGIKIKEDEIKKEI
EGCFIEKEGKRTDVIVLACTHYPLIVHVFRQLSPWPVDWLDNSDSIARRARCLLPRINTH
QTRVFDDHALFLSGKPDIAMRRLMQGFGLKS
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagataactatccttgtgaaaaaaaacttcagaatagtattcttatcttcgac
agtggtatcggcggacttattgtcttgcaaaaaatgcgttttttaatgcctgaatatcac
tttatttacgttgccgatgatgttggtttcccttatgggaattgggaagatcatgcatta
aaaaaacgtcttatgtttcttttttcagatattttagacaagtatcaacccgtattatca
gtcatagcgtgtaatactgcttttactttgattaaagatgagttgcgttcaacttttcca
tccatggcttttcttggtgcagttcctgctatcaaacaggcagcagcttatacacaaagt
ggtttaatttctattttatcaacgcctgcgacactaaggcgtacatacaccagtaatttg
attcattcttatgtatcacaatgtcatattcatcttgtttcttcgatgatactagcgtct
agagtagaggagtatgcttgtgggatcaaaatcaaagaggatgaaatcaaaaaagaaata
gagggatgtttcattgaaaaagagggtaaacggactgatgttattgtacttgcttgtaca
cattatcctttgatcgtgcatgttttccgacaactatctccttggccagtagattggttg
gataattcagattccatagctcgtcgtgctcgttgtctgctgccgagaattaacacacat
cagactagagtattcgatgatcatgcgctttttttatcgggtaaaccagatatagctatg
cgacgtttaatgcaaggatttggtttaaaatcttga

DBGET integrated database retrieval system