KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04050Help
Entry
CLIBASIA_04050    CDS       T00948                                 

Definition
(GenBank) formyltetrahydrofolate deformylase
  KO
K01433  formyltetrahydrofolate deformylase [EC:3.5.1.10]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00630  Glyoxylate and dicarboxylate metabolism
las00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:las00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CLIBASIA_04050
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CLIBASIA_04050
Enzymes [BR:las01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.10  formyltetrahydrofolate deformylase
     CLIBASIA_04050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N ACT_6
Motif
Other DBs
NCBI-ProteinID: ACT57384
UniProt: C6XG81
Position
complement(888733..889599)
Genome map
AA seq 288 aa AA seqDB search
MSSYILTITCPSNEEITSIIPDYLSTQGCNILDISQFNDLDTSKLFMRISFVFNTCMKLF
IADFQPIVQQFSLQYSIRNTKEATKTLILVSQPDHCLNDLLYRWNIGTLALNIVGVVSNH
TTHKKLVENYQLPFYYLPMTEQNKIESEQKLINIIEKNNVELMILARYMQILSDHLCHKM
TGRIINIHHSFLPSFKGANPYKQAYEYGVKIIGATAHYAICELDAGPIIEQDVVRVTHAQ
TIEDYIAIGKNIEAKVLTKAVNAHIQQRVFINKRKTIVFPAYPNNYFQ
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgtctagttacatcttaaccatcacctgcccgtccaatgaagaaatcacttctatcatt
cccgactatttatctacacaaggatgcaatatattagacatatctcaatttaatgattta
gataccagcaaattgtttatgcgaataagctttgtgtttaatacttgcatgaaactcttc
attgccgattttcaaccaattgttcagcaattttcgttacagtactctatccgaaacaca
aaagaagcgacaaaaaccctcatcttagtctcacaacctgatcactgtctcaatgaccta
ttatataggtggaacattggcactctcgctcttaacatagttggcgtagtatctaatcac
accacgcataaaaaactagtcgaaaattatcaacttccattttattatcttcccatgacg
gaacaaaataaaatagaatctgaacaaaaattaatcaatataatagaaaaaaacaacgta
gaactcatgatcttagcacgatacatgcaaattctttctgatcacttatgtcacaaaatg
acaggacgcatcatcaatatacatcactcgtttttgccatcttttaaaggagcaaacccc
tacaaacaagcatatgaatatggtgtaaaaattattggagctacagcacattatgctatt
tgcgaactagatgcaggtcctattatagaacaagatgttgtacgcgttacacatgcacaa
actatcgaagattacatcgcaatagggaaaaatatagaagcaaaggttttaacgaaagca
gtaaacgctcatattcaacagcgcgtctttatcaacaaacggaaaactatcgtctttcct
gcttatccaaataattattttcaataa

DBGET integrated database retrieval system