KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04070Help
Entry
CLIBASIA_04070    CDS       T00948                                 

Definition
(GenBank) oligoendopeptidase F
  KO
K08602  oligoendopeptidase F [EC:3.4.24.-]
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:las01002]
    CLIBASIA_04070
Enzymes [BR:las01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     CLIBASIA_04070
Peptidases [BR:las01002]
 Metallo Peptidases
  Family M3
   CLIBASIA_04070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M3 Peptidase_M3_N Peptidase_M78
Motif
Other DBs
NCBI-ProteinID: ACT57388
UniProt: C6XG85
Position
complement(893296..895176)
Genome map
AA seq 626 aa AA seqDB search
MTKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECI
EHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPT
IRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKH
LLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKS
AAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQS
VKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSP
QMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGH
GIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDML
NSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMM
VPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLN
INLSDPNFWERGLQTVEKMIDDVEKM
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaatatcctgactatgaatttttttctaatgctttcttccgcaaagctcttcgt
tcctctgatatgacaacaatggattctcaagaaaatctagggaatctccctcgctggaat
ttagaagatctctatccatcccatgatagccaagaaatttcaaatgatatggaatgcatt
gagcatgagagtttagcttttaaaacacgttgggaaggtaatttagcacatgctactaat
cagaaaaactgccatagcttaggggcagctatcgctgaatatgagagaatttgcgaactc
atcggacgtatcgcctcttatgccatgttatcgtacaactgtaatctatctagcccaact
attcgcaagttttatacagacataaatgcaaaacttgctgattttgaaaaagtactcatc
ttttttgcgctggaaatcaatactctggatgaagcgcttttagaacaatcctatgctcaa
gatcccttaacacttaagtactctgcatggataaaaaatataagaaaaatcaagaaacac
ttattgtccaatgatatggaatgtctcttatccgatacatctcaagtaggaagagaagcg
ctcaaacgctttttttgcgaaaatatagaatctctccgatttaaaataaatgaccaaaaa
ataccactaacaaaagcatataagtcattctttgattctgatagagaagttcgtaagtca
gctgctaaagcgctctctcatacattcaataagagtagccatattttttcttttattacc
aacactttggcaaaagatgaagaaattcaggatcgttggagaaaatatgaaaaaattgct
gacagtcgtcatttatctaataatgtagaaccatatgtgatagaagcccttatgcaatct
gttaaaaattattatccaaagacatcacataggtattatgaattaaagaaaaaatggcta
aaattagataccatgtatttttgggatcgccttgcccctttaccaggaacatctcaggac
atcattccttttgaagtagcacgagatctcgttcttcaatcttatgctaaattttctcct
caaatgtctataattgccgaaaagttttttactcataattggattgatgctcctcaatat
gatggaaaaggatcgggagcttttgcacacggcactataccttcagtacatccatatatc
ttattgaattatttaggaaaaccgcaggatgtgatgacactagctcatgaactaggtcat
ggtattcactttgtactttcatcagaaacacaaggaattcttacgaataattcttcgctg
acgttagcagaaaccgcttctatttttggtgaaactttaacttttgattctttactccaa
gcagcctctagtaaggaagaacgcaaaattttgctagccaataaaattgaagatatgctg
aacagcatcgtacgacaaatttccttctacgattttgagttaaaattacatacagaacgc
cgatcgactggagatattcccacccatagaatcaatgaaatatggcttgaaactcaaaag
gaatctcttggccctgcttttgatttaagtgatttggaatacggtagtttttggatgatg
gttcctcattttattgagagttctttttacgtatatgcatatgcctttggcaattgtctt
gttaattcactatatgatatatataagagcaataccgtcgattgctttaaggaaaaatat
ctcaatattctgcgtgctggaaattcaaagcattactcagaacttctgttacctttgaac
attaatctttctgatccaaatttttgggaaagaggattacaaacagttgaaaaaatgatt
gatgatgttgaaaagatgtaa

DBGET integrated database retrieval system