KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04080Help
Entry
CLIBASIA_04080    CDS       T00948                                 

Gene name
mdlB
Definition
(GenBank) ABC transporter, nucleotide binding/ATPase protein
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:las02000]
    CLIBASIA_04080 (mdlB)
Transporters [BR:las02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    CLIBASIA_04080 (mdlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA AAA_29 AAA_30 AAA_22 RsgA_GTPase AAA_16 AAA_23 ABC_ATPase AAA_21 AAA_15 AAA_18 AAA_24 Zeta_toxin AAA_5 MMR_HSR1 G-alpha AAA_14 AAA_19 AAA_33 EF1G
Motif
Other DBs
NCBI-ProteinID: ACT57390
UniProt: C6XG87
Position
897303..899093
Genome map
AA seq 596 aa AA seqDB search
MRNFFFVLDKVMSPSDREMLSRLIRENIHKHVTWYSMSIVAMITVSLMTSCSAWIMRDVM
NAMVASTDIFHVIVVSSTVAGIFIVKGIASFVQNYYLSCAGNSIIAEQQRKIYRRLLQYG
MEFYDSNQSSELQVRFTHATQSVRSVVDIFITSFLRDFLTLVGLIVVMFLQEPTLSLCTI
IIGPLCILGVRILVKRVRHIMEQGMVAIGHIIQNLQETVIGIRIVKSFAMEEVMNQRMCN
MIKEVEDRLNKVAKIESATSPIMETISGLSIAGIILFSGFLMSKKGTSNAGEIMSFITAL
LMAYEPAKRIARTRIILEGGMVGVRCMFSLLDHPIMIEESPHAVNLPVGKGTTVFRDVFF
SYKQGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDI
TFSSLRERISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYD
TYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQGRT
TIVIAHRISTIIEADHIIFIEDGKVSESGDQKYLLQQKDGSLYKKMYASQLLENLS
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaggaattttttttttgtattagacaaagtaatgtctccttccgacagagaaatgcta
tcacgtctcataagagagaatatccataagcatgtaacatggtattctatgtctattgtt
gcaatgataaccgtttctttgatgacatcatgcagtgcatggattatgcgtgacgtgatg
aatgcaatggttgcatcaacggatatttttcatgttattgttgtttctagcacggtagct
gggatattcattgtaaagggcatcgcctctttcgtgcaaaattactacctcagttgtgca
ggtaattccattattgcggagcagcaaaggaaaatataccgtcgccttcttcaatatgga
atggagttctatgatagcaatcaatcttctgaattgcaagtacggttcacccatgccacg
cagtcagtaagaagtgttgttgatatattcattacttctttcctgcgtgactttttaaca
ctcgtcggattgatagtagtgatgtttttgcaagagccgacgttatcattgtgtactata
atcattggtcctctttgcattttaggtgttcgtattctcgttaaaagagtacgtcatatt
atggagcaggggatggttgctattggccatattattcagaatctgcaagagactgttata
ggtattcggatagtaaaatctttcgcgatggaagaggttatgaaccagcgtatgtgtaat
atgataaaggaagtagaagatcgcttaaataaggtggccaagatagaatctgctacgagt
ccaatcatggaaactatatcaggattatccatagcgggaattattcttttttctggtttt
ttaatgtctaaaaaaggcactagcaatgctggtgagattatgtcctttattacggcttta
cttatggcatacgaacctgcaaagcgtattgcgcgcactcgtattattttagagggggga
atggttggagtacgttgtatgttttctcttcttgatcatcctattatgattgaggaaagt
cctcatgcagtaaatttgcctgttggaaagggaacaactgtatttcgtgacgtctttttt
tcatataaacaagggcatcctgtcctttcaggaataaatctttgtttcaaatcagggaaa
atgacagccttggttggaccttcgggcagtgggaaatcaacgatcattaatttgttaatg
cgtatgtatgatccgtcatctggatcgattgagattgatggtattaatattcgcgatatt
actttttcttctttacgagaacgtatctcatatgttgggcaagatgtttttttgttctct
aatacagtaagatataacatacttattggacgtccgatggctactgaagaagaaatgatc
gaaattgctaaatctgctaatgcacatgattttatcatgagcttgccccaaggatatgat
acatacgtaggcgaaaatggtagtaatctttctggtggacaaaaacagcgtatagcaatt
gcacgtgctatgttacgagatggtcatattcttgtcttagatgaagctactagtgctttg
gatacgcatactgaaaaccttgttcgccaagctctttcccgtttaatgcaaggacgtacc
acaattgttattgcacataggatctcaacaattatcgaagctgatcatattatctttata
gaagatggtaaagtatctgaatcaggagatcaaaaatatttgttacagcaaaaagatggt
agtttatacaaaaagatgtatgcttcacagctacttgaaaatctatcataa

DBGET integrated database retrieval system