KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04140Help
Entry
CLIBASIA_04140    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACT57402
UniProt: C6XG84
Position
915598..916824
Genome map
AA seq 408 aa AA seqDB search
MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHV
IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSL
PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA
SRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVG
TLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA
SQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTR
YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaataagaattttttattaggcgttttgcgtctaaaaaagtgcacgcgtggt
gtttttttagttattacagctattttattgtcttcttttgtcgccatagtagatgttgtg
gtagatcaggtgacggtgatgcagaaaacagcttggcttcaagaggtcttggatcatgtt
atttatcgcacttctccaaaaaatttatatgatttaagggaagcgggtagagataatttt
ataagacatcaaattgaaaaggctttaaatacttataattccagagatctttcaaatatt
gggagtatagaatcaatcgttaaagatgctgttattttaacgaaaaatgttaattctttg
cctttacaatttactgtcgacatcgccctttcgacaacggttcaattgcgaggatctctt
ttgcagatgttttcgcaatcgaagggtaaagttgatatttctcgtcgaaaaaaagttatg
tataaacaaaatattggtttaatgattatgccttttgcatgggatggctattggctagct
tcaagaggaaaggttgcagactcaaaagtacatcctccaaagtatttggagtattctcat
tattatcagcagtatcttaatagaaatacgcttgtgaaaaattttctctcacaaattcct
tataaaaatttctgtatggctccttatcattattcttctattctttattgggcagtcgga
accttgacgtatagcgtggataacaagacgactacgcgcgaatattataaggatccttac
tatgctacatgggatcattttccttattcatttatcaagaacgtatttgacatgacttcc
aatcaatttggagatgggcaggtattgactaataccaatcattgctttcctcatggagca
agtcagaataaatatatgttgatgcttgcgataggaaatcagctatctcgaagttcagta
gagaaagaaaaaatagaaaaggttctgcaagactgccattacatgcataagcgtcataga
actggaagagatgcaattaccatattttctgtaggattttctccggatcaagatacgcga
tatactttaagacaatgtgcaagtgatccatctaaatattatgaaattaattctgacgag
aatgtcatgcctatagccaaaagtcttgcacgtaatgttataactaattggtttagtcag
tttacaattactgtggtcgatagctag

DBGET integrated database retrieval system