KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04145Help
Entry
CLIBASIA_04145    CDS       T00948                                 

Gene name
nodT
Definition
(GenBank) nodulation protein (outer membrane efflux protein)
  KO
K18904  outer membrane protein, multidrug efflux system
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:las02000]
    CLIBASIA_04145 (nodT)
Transporters [BR:las02000]
 Other Transporters
  Pores ion channels [TC:1]
   CLIBASIA_04145 (nodT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OEP Cytochrom_D1
Motif
Other DBs
NCBI-ProteinID: ACT57403
UniProt: C6XGA0
Position
complement(917027..918385)
Genome map
AA seq 452 aa AA seqDB search
MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS
LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL
DSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI
LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP
ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY
PSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE
TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERA
TAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaatattctacgagccattttttctctttttattgtattgctggcaggatgcacagtg
ggtcccgaatatacaaaacctcacatgccactattacccacacaattttctataggcaat
tcaaaaaacctaatcaatatagacacgctcaaatggtgggaatcatttaacgacacttcc
cttaataaacttgtcaaaatcgccctacaacaaaatctcacaatacttcaagcaacagaa
cgcataaatgccgcaaaagaaaatattttatctgtcagagctgatcttttcccttcttca
tatgcctcaatatctcatcgctttatacctaacttaaagactaattctacaggacaatta
gattctgattggaaaattgatctatttggacaaaggagacacatagaaagctccctagca
aaccttgatagtgcatatgcccaagtggatatagcaaaactcaatgttatttccaaatta
ataccatcatatatagatgcacgtcatttcaaggaaaggatatccattgctcatcaaata
ttggatttgtacaaaaaaaatatagaattaagtcaccttaaattcacccaaggagccaca
tcaaaattatctcttgtgaaactagaggcagaaataaaatcaattgaatccgacatacct
accctcgaaaaaagcttccgtatgaacgtgcataacatctctactcttcttggttatccc
gctactgagtttttacattacatgcaaaagcaatctaataattttcaaccgaatttatat
atacccattaatatcggaatccccgcagatctgattcgaaacaggccagatattcgctat
caagagaaaaagctcgctgattctgtagctaaaataggtatagctaaatccgacctctat
ccttccctttcattgaatggttccatcgcccttacacacgacaatagttttcccggatat
aatacccattggtcttttggtccaaaactatacctaccaatttttgataagggaaaaata
aaatctaacatacgtagagctgagtcttctgcacaagagcagtacatcacatggcaagaa
acagtattaaatgctatcaaagaagttgaaaatgcactgacatctattaacgaagataaa
aaaattgttacaaaacttcaacatgccgtggaactacataaaaaatctatgtcactatca
atgatcaattatcgtcaagggagatattccttactcgatatattggatatagaacgtgct
actgcaaaagtagaagttgatttatctattgccaaaagacaattggcaaagagctatgta
gatctttatatcgctattggaagtggatataatccgtag

DBGET integrated database retrieval system