KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04145Help
Entry
CLIBASIA_04145    CDS       T00948                                 

Gene name
nodT
Definition
(GenBank) nodulation protein (outer membrane efflux protein)
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OEP Cytochrom_D1
Motif
Other DBs
NCBI-ProteinID: ACT57403
UniProt: C6XGA0
Position
complement(917027..918385)
Genome map
AA seq 452 aa AA seqDB search
MNILRAIFSLFIVLLAGCTVGPEYTKPHMPLLPTQFSIGNSKNLINIDTLKWWESFNDTS
LNKLVKIALQQNLTILQATERINAAKENILSVRADLFPSSYASISHRFIPNLKTNSTGQL
DSDWKIDLFGQRRHIESSLANLDSAYAQVDIAKLNVISKLIPSYIDARHFKERISIAHQI
LDLYKKNIELSHLKFTQGATSKLSLVKLEAEIKSIESDIPTLEKSFRMNVHNISTLLGYP
ATEFLHYMQKQSNNFQPNLYIPINIGIPADLIRNRPDIRYQEKKLADSVAKIGIAKSDLY
PSLSLNGSIALTHDNSFPGYNTHWSFGPKLYLPIFDKGKIKSNIRRAESSAQEQYITWQE
TVLNAIKEVENALTSINEDKKIVTKLQHAVELHKKSMSLSMINYRQGRYSLLDILDIERA
TAKVEVDLSIAKRQLAKSYVDLYIAIGSGYNP
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaatattctacgagccattttttctctttttattgtattgctggcaggatgcacagtg
ggtcccgaatatacaaaacctcacatgccactattacccacacaattttctataggcaat
tcaaaaaacctaatcaatatagacacgctcaaatggtgggaatcatttaacgacacttcc
cttaataaacttgtcaaaatcgccctacaacaaaatctcacaatacttcaagcaacagaa
cgcataaatgccgcaaaagaaaatattttatctgtcagagctgatcttttcccttcttca
tatgcctcaatatctcatcgctttatacctaacttaaagactaattctacaggacaatta
gattctgattggaaaattgatctatttggacaaaggagacacatagaaagctccctagca
aaccttgatagtgcatatgcccaagtggatatagcaaaactcaatgttatttccaaatta
ataccatcatatatagatgcacgtcatttcaaggaaaggatatccattgctcatcaaata
ttggatttgtacaaaaaaaatatagaattaagtcaccttaaattcacccaaggagccaca
tcaaaattatctcttgtgaaactagaggcagaaataaaatcaattgaatccgacatacct
accctcgaaaaaagcttccgtatgaacgtgcataacatctctactcttcttggttatccc
gctactgagtttttacattacatgcaaaagcaatctaataattttcaaccgaatttatat
atacccattaatatcggaatccccgcagatctgattcgaaacaggccagatattcgctat
caagagaaaaagctcgctgattctgtagctaaaataggtatagctaaatccgacctctat
ccttccctttcattgaatggttccatcgcccttacacacgacaatagttttcccggatat
aatacccattggtcttttggtccaaaactatacctaccaatttttgataagggaaaaata
aaatctaacatacgtagagctgagtcttctgcacaagagcagtacatcacatggcaagaa
acagtattaaatgctatcaaagaagttgaaaatgcactgacatctattaacgaagataaa
aaaattgttacaaaacttcaacatgccgtggaactacataaaaaatctatgtcactatca
atgatcaattatcgtcaagggagatattccttactcgatatattggatatagaacgtgct
actgcaaaagtagaagttgatttatctattgccaaaagacaattggcaaagagctatgta
gatctttatatcgctattggaagtggatataatccgtag

DBGET integrated database retrieval system