KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04150Help
Entry
CLIBASIA_04150    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RE_HaeIII
Motif
Other DBs
NCBI-ProteinID: ACT57404
UniProt: C6XGA1
Position
complement(918382..918552)
Genome map
AA seq 56 aa AA seqDB search
MDYPCNKEYFKTISTVFGKLGDMRAQNIFLKDIKDKDIIFYLHILIAFEKVIDYLL
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
atggattacccttgtaacaaagaatactttaaaactatttcaactgttttcggtaaacta
ggagatatgcgagcacagaatatctttcttaaagatatcaaggacaaagatataatcttt
tatctccatattttaatcgctttcgaaaaagtaattgactatttattatga

DBGET integrated database retrieval system