KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04155Help
Entry
CLIBASIA_04155    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
  KO
K09991  uncharacterized protein
Organism
las  Candidatus Liberibacter asiaticus psy62
Brite
KEGG Orthology (KO) [BR:las00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    CLIBASIA_04155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2497 SRP54_N DEK_C
Motif
Other DBs
NCBI-ProteinID: ACT57405
UniProt: C6XGA2
Position
920276..920986
Genome map
AA seq 236 aa AA seqDB search
MAQYNAVSEPSMEEIVNSIRRILENNDQEFSTSNNVQTQVPARDEGVIEKEDFVQEDKMS
NHLFADQNSHLKKYGVEYPKKETMSLSDVAARVRAEARGDARIIADAPSPIANSILPSTD
ALEENAVMDKPLNEGLSPSSDLGMQAEESMYSPDLVDKCKGEEEALVSSDVGDQVASSFD
QLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERLVREEIERIARGPIRH
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcccaatataatgctgtatccgaaccgtctatggaagaaatagttaattctattcgc
aggatactggagaataatgatcaagagtttagtacttctaataatgtacaaactcaagtc
ccagcacgcgacgaaggtgtaatcgaaaaagaggattttgtgcaagaggataaaatgtct
aatcatctttttgcagatcaaaattcccatttgaagaaatatggtgtcgagtatcctaaa
aaggagactatgtcactttctgatgttgcggcgcgcgttcgtgcagaagctcggggtgat
gctcgtattattgctgatgcaccttctcctatagcaaattcgattcttccttctacggac
gcattagaggaaaatgctgtcatggataaacccttgaatgaaggtttatctccgagttca
gatcttggtatgcaagcggaggaatcaatgtattctcctgatcttgttgataaatgcaag
ggggaagaggaggcgttagtttcatctgatgttggagatcaggttgcttcttcttttgat
cagttggtaaaggcgcttcgggaatctgagagtcgttctcttgaccagctatctttggat
gtactacgtcctatgttgcgtgagtggctagatgataacttaccaggaattgtggagaga
cttgtgcgggaggaaatagagagaattgcaagaggtcctattcgacattag

DBGET integrated database retrieval system