KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04160Help
Entry
CLIBASIA_04160    CDS       T00948                                 

Gene name
valS
Definition
(GenBank) valyl-tRNA synthetase
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
las  Candidatus Liberibacter asiaticus psy62
Pathway
las00970  Aminoacyl-tRNA biosynthesis
Module
las_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:las00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CLIBASIA_04160 (valS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:las01007]
    CLIBASIA_04160 (valS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:las03016]
    CLIBASIA_04160 (valS)
Enzymes [BR:las01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     CLIBASIA_04160 (valS)
Amino acid related enzymes [BR:las01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CLIBASIA_04160 (valS)
Transfer RNA biogenesis [BR:las03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    CLIBASIA_04160 (valS)
 Prokaryotic Type
    CLIBASIA_04160 (valS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g Val_tRNA-synt_C tRNA-synt_1_2 tRNA-synt_1e tRNA-synt_1f tRNA-synt_1b PRKG1_interact
Motif
Other DBs
NCBI-ProteinID: ACT57406
UniProt: C6XGA3
Position
921065..923908
Genome map
AA seq 947 aa AA seqDB search
MMIDKTYDFAFIEQKSVEKWNSVDAFRIDVAPKLGSGVFCIAMPPPNVTGSLHMGHAFNT
TIQDIMIRFERMRGKNVLWQPGTDHAGIATQITVESRLFAQSSLTREDIGRDAFIEKVWE
WKKESGGSILSQLKRLGASCDWSRERFTMDEGMSNAVRNAFVVLYKDGLIYRDKRIVNWD
PSLKTSVSDLEVIQKEVDGNLWYVRYPLVEGVTYRHPIKFDDDAKPIDWEVRDYIIVSTT
RPETMFGDVAIAVHPDDYRYKELIGKYATLPIVGRLIPIVSDVYPDPEFGDGAVKVTPAH
DFNDFEIAKRHGLGFINILTPEAKIFLSENESFLENIVLSDEARNIFSEFEGLDCFAARS
KIVSLLEKSNLLDKTDSYRHIVPHCERSGVTIEPCITEQWYLDAKVLAESAIRSAKNGCL
SFIPQSWDKSYYEWLENIQPWCISRQIWWGHQIPVWYSPDGKLFVENTEDAALRSAIDYY
LSQDNDMTVKVRKMIKDGNISDLLKRDEDVLDTWFSSALWPFASLGWPEQTAELKTYYPT
SVLVTGFDILFFWVARMMMMGLYFMKDAEGKGIEPFHIVYMHALVRDKNGQKMSKSKGNV
VDPIDVIDQYGADALRFYFSIMAVQGRDINLDLERIAGYRNFITKFWNAIRFSKMKNARH
SVSFVPQDVKWIVNKWIIKRLATVINDVTVGMENHRFNDVSAVLYRFVWDELCDWYVEFI
KSILNQKDSELVSETLSCFSYVLYNVCKLLHPIIPFVTEDLYSHVSPQDDMDKQGLLCHA
QWPSLIIDDSESIEEVNWIIDLISKVRSIRTEMNVPLKAVVPLVFANIDAHVRKRLECHK
CIIDRLSSGNIIFADCPPDRSIQIILDGMVLFLAIGDFVDFVKERSRLKKSLEKVLDELS
SIKKKLENNQFVEKAPPSILQAEKERFSKVEKKRISLENSLERIRML
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgatgattgataaaacatatgatttcgcttttatagaacagaagagtgtagagaagtgg
aattctgttgatgcgtttcgcattgacgttgctcctaagctaggatcgggggtattttgc
attgctatgcctccacctaatgtgacgggttcattgcacatggggcacgcttttaatacc
accatacaggatatcatgatccgttttgaacgtatgagaggaaagaatgttctttggcag
ccaggaacggatcatgctggtatagctactcagataacagtcgaatctcggttatttgcc
caatcttccctcacgcgagaggatattgggcgtgacgcttttattgaaaaagtttgggag
tggaaaaaagaatcgggaggatctatcctcagtcagttaaaaaggttaggtgcatcatgc
gactggtctcgtgagagattcacaatggatgagggaatgtccaacgcagttcgcaatgct
tttgttgttctctataaagacggtttaatctatagagataagaggattgttaattgggat
ccatcgcttaaaacttctgtctctgatctcgaggttattcaaaaagaagttgatggcaat
ctgtggtacgtacgctatccattagtagaaggagttacgtatcgtcacccgattaaattt
gatgatgatgcaaagccaattgattgggaggttcgtgattatattatcgtgtctacgact
cgtccagaaacgatgtttggggacgttgctattgctgttcatcctgacgattatcgttat
aaggagcttattggaaaatatgccacgcttcctatagtgggtcgtcttattcctattgta
tctgatgtttatcctgatcctgaatttggggatggagccgttaaagtgactcccgcacat
gattttaacgattttgagatagcaaagcgtcatggattaggttttatcaatattttaacg
cctgaagcaaagatttttctctcagaaaatgaaagttttttagagaatattgtcctttcc
gatgaagcaagaaatatttttagtgaatttgaaggcttggattgttttgcggctcgctcg
aaaatagtttcattgcttgaaaaaagtaatttgcttgataaaactgattcttacaggcat
atagtaccccattgtgaacgtagtggtgttactattgagccttgtataacagagcaatgg
tatcttgatgctaaggttttagctgaatctgctatccgttcggcaaagaatggttgtcta
tcatttattccacaatcttgggataagagctattatgaatggttagaaaatattcaacct
tggtgtatctcacgacagatttggtgggggcaccagattcctgtttggtattctcctgat
ggaaaattattcgttgaaaataccgaagatgccgctttacgctctgccattgactattat
ctttcgcaggataatgacatgactgtaaaagtgcgaaaaatgatcaaagatggtaatata
tctgatcttttaaaacgtgatgaagatgtattagatacttggttttcttccgctctttgg
ccttttgcgtctcttggttggccagaacaaactgctgaattaaagacttattatcctacg
agtgttctggtcacagggtttgatattttgtttttctgggtcgcacgtatgatgatgatg
ggcctgtattttatgaaagatgctgaaggtaagggaattgaaccattccacatcgtttat
atgcacgcattggttcgagataaaaatggacaaaaaatgtctaaatctaagggcaacgtt
gtcgatccaattgatgtgatagatcaatatggtgcagatgctctgcgattttatttttct
atcatggcggttcaagggcgtgatatcaatttggatttagagcgtattgctggttatcgt
aattttataactaaattttggaatgctatacgcttttcaaagatgaaaaatgcaaggcac
agtgtttcttttgtaccacaagatgtgaagtggattgttaacaaatggatcatcaagcgc
ctcgctactgtgatcaatgatgttactgtaggaatggaaaatcatcgttttaacgatgta
tctgctgtattgtatcgttttgtatgggatgagttatgtgattggtacgtggagtttatt
aagtctattctcaatcaaaaagatagtgaattggtttcggaaactttatcatgtttttca
tatgtcttgtataatgtttgcaagttgttacatccgattattccgtttgtgacagaagat
ctttattctcatgtatctccacaggatgatatggacaagcaaggtcttttatgtcatgcg
cagtggccttcacttattattgatgattctgaatctatagaggaggtaaattggattata
gatttgatctccaaggttcgttctatccgtacagaaatgaatgttccattaaaagcagtg
gtgccattggtatttgccaatatagatgcacatgtgcggaaacgattagaatgtcataag
tgtattattgatcgtttatcttcagggaatattatttttgcagattgtcctccagatcgt
tcgattcaaattattcttgatgggatggtattatttctggcaatcggtgatttcgtcgac
tttgtcaaagagagatctcggctcaaaaagtctctcgaaaaagtactcgatgaattatct
tctataaagaaaaagttagagaataatcagtttgtagaaaaggctcctccaagtatttta
caagcagaaaaggaaagattttctaaagttgaaaagaaaagaatatctttagaaaattct
cttgagcgcataagaatgttgtag

DBGET integrated database retrieval system