KEGG   Candidatus Liberibacter asiaticus psy62: CLIBASIA_04165Help
Entry
CLIBASIA_04165    CDS       T00948                                 

Definition
(GenBank) hypothetical protein
Organism
las  Candidatus Liberibacter asiaticus psy62
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA VWA_2 TadE vWA-TerF-like Tad
Motif
Other DBs
NCBI-ProteinID: ACT57407
UniProt: C6XGA4
Position
924400..925524
Genome map
AA seq 374 aa AA seqDB search
MFSLNLNIRNFFYNYKGGMTILTAIFLPIIFLVLGMIIEVSHIFFMKTVLHSMIDRSLVH
AATQIMNEGNGNNRKKLKGGDILCRIKNTWNMSFRNELRDNGFVNDIDDIVRSTSLDIVV
VPQNEGYSISAISRYKIPLKFCTFIPWYTNSRHIVMPITSSVKVNSQTDARLDMMIVLDV
SRSMESFFDSSITKIDMAIKSINAMLEEVKLIPDVNNVVQSGLVTFSNKIEEFFLLEWGV
SHLQRKIKYLSKFGVSTNSTPGLKYAYNQIFDMQGMRQHCNTEDANYKKIIVFMTDGENL
STKEDQQSLYYCNEAKKRGAIVYAIGIRVIRSHEFLRACASPNSFYLVENPHSMYDAFSH
IGKDIVTKRIWYDK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgttttctttaaatttaaatattcgaaattttttttataattataaaggcggcatgacg
atattaacggctattttcttacctattatatttcttgttttaggaatgattattgaagta
tcacatatcttttttatgaagacagtattgcactctatgattgatcgttctcttgtgcat
gcagcaacacaaataatgaatgaagggaatggtaacaatagaaagaaactgaaaggcggt
gatatcctatgtagaataaagaatacgtggaatatgagttttcgcaacgaattacgcgat
aatggctttgtaaacgatattgatgatatagtacgatcgacatcgcttgatattgtcgta
gttcctcaaaatgaaggatacagtatatcggctatctctcgatataaaattccattgaag
ttttgtacttttattccttggtatacaaatagtcgtcatattgtaatgccgataacgagc
tctgtaaaagttaatagccaaactgacgctcgattagatatgatgatagttttagatgtt
tctcgttctatggaaagtttttttgattcgtctataacaaaaatagatatggctataaaa
tcgatcaatgcaatgttggaagaagttaaattaattccggatgtgaataacgtagttcaa
agtggattagtgacattttctaataaaattgaggaattttttttgttggaatggggagtc
agtcatcttcaaagaaaaataaaatatctttctaagtttggcgtgagtacaaactcaact
cctgggttgaaatatgcttataatcaaatttttgatatgcagggaatgcggcaacattgt
aatacagaagatgccaattataaaaaaattatcgtatttatgacagatggagaaaatctt
tcaacgaaagaagatcagcaaagtctttattattgtaatgaagcaaaaaaaagaggggca
atagtttatgcaattggtattcgagtcatcaggtctcacgaatttcttagggcatgtgct
tcgccaaacagtttttatctagttgaaaatccccatagtatgtatgatgcgttttcacat
attggtaaagatatagtcacaaaacgtatttggtatgataaatga

DBGET integrated database retrieval system